Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein BU385 |
NCBI Accession ID | BA000003.2 |
Organism | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium) |
Left | 425949 |
Right | 426191 |
Strand | + |
Nucleotide Sequence | ATGGACAATCAAGAAATAAAATTATTACTTATTAAAAAATTAAATTTAGAACAAGCTAATATTACAGGAGACAGCAATCATATAAAAATAATTGCTATAGGAAATATTTTCAAAAATGTCAGCCAAGTAAAAAGACAACAAATAATTTATGCCCCTTTAATAGATATGATTAAAGAAAAACATATTCATGCTGTATCTATAATGTCCTATACACCGGAAGAATGGGAAAAAACAAAAAAATAA |
Sequence | MDNQEIKLLLIKKLNLEQANITGDSNHIKIIAIGNIFKNVSQVKRQQIIYAPLIDMIKEKHIHAVSIMSYTPEEWEKTKK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00386. Profile Description: BolA-like protein. transcriptional regulator BolA; Provisional |
Pubmed ID | 10993077 |
Domain | CDD:412350 |
Functional Category | Others |
Uniprot ID | P57465 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1101815 | 1102069 | - | NZ_CP011254.1 | Serratia fonticola |
2 | 226783 | 227037 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
3 | 4305748 | 4306002 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
4 | 352302 | 352556 | + | NZ_CP025799.1 | Dickeya zeae |
5 | 1547339 | 1547593 | + | NZ_CP029736.1 | Providencia rettgeri |
6 | 3041321 | 3041575 | - | NZ_CP031123.2 | Providencia huaxiensis |
7 | 943888 | 944142 | - | NZ_CP065640.1 | Serratia rubidaea |
8 | 3397970 | 3398224 | - | NZ_LR134531.1 | Pragia fontium |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00275.22 | 1.0 | 8 | 54.0 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
2 | PF13466.8 | 1.0 | 8 | 175.0 | same-strand | STAS domain |
3 | PF05494.14 | 1.0 | 8 | 484.5 | same-strand | MlaC protein |
4 | PF02470.22 | 1.0 | 8 | 1129.0 | same-strand | MlaD protein |
5 | PF02405.18 | 1.0 | 8 | 1684.5 | same-strand | Permease MlaE |
6 | PF00005.29 | 1.0 | 8 | 2471.5 | same-strand | ABC transporter |
7 | PF13365.8 | 0.88 | 7 | 2327.0 | opposite-strand | Trypsin-like peptidase domain |
8 | PF00089.28 | 0.88 | 7 | 2523 | opposite-strand | Trypsin |
9 | PF17820.3 | 0.88 | 7 | 2539.0 | opposite-strand | PDZ domain |
10 | PF13180.8 | 0.88 | 7 | 2327.0 | opposite-strand | PDZ domain |
11 | PF00595.26 | 0.88 | 7 | 2539.0 | opposite-strand | PDZ domain |
12 | PF06295.14 | 0.88 | 7 | 4376 | opposite-strand | Protein of unknown function (DUF1043) |
13 | PF03969.18 | 0.62 | 5 | 4846 | same-strand | AFG1-like ATPase |