Result : P57465
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein BU385 |
| NCBI Accession ID | BA000003.2 |
| Organism | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium) |
| Left | 425949 |
| Right | 426191 |
| Strand | + |
| Nucleotide Sequence | ATGGACAATCAAGAAATAAAATTATTACTTATTAAAAAATTAAATTTAGAACAAGCTAATATTACAGGAGACAGCAATCATATAAAAATAATTGCTATAGGAAATATTTTCAAAAATGTCAGCCAAGTAAAAAGACAACAAATAATTTATGCCCCTTTAATAGATATGATTAAAGAAAAACATATTCATGCTGTATCTATAATGTCCTATACACCGGAAGAATGGGAAAAAACAAAAAAATAA |
| Sequence | MDNQEIKLLLIKKLNLEQANITGDSNHIKIIAIGNIFKNVSQVKRQQIIYAPLIDMIKEKHIHAVSIMSYTPEEWEKTKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00386. Profile Description: BolA-like protein. transcriptional regulator BolA; Provisional |
| Pubmed ID | 10993077 |
| Domain | CDD:412350 |
| Functional Category | Others |
| Uniprot ID | P57465 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1101815 | 1102069 | - | NZ_CP011254.1 | Serratia fonticola |
| 2 | 226783 | 227037 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 3 | 4305748 | 4306002 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 4 | 352302 | 352556 | + | NZ_CP025799.1 | Dickeya zeae |
| 5 | 1547339 | 1547593 | + | NZ_CP029736.1 | Providencia rettgeri |
| 6 | 3041321 | 3041575 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 7 | 943888 | 944142 | - | NZ_CP065640.1 | Serratia rubidaea |
| 8 | 3397970 | 3398224 | - | NZ_LR134531.1 | Pragia fontium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034035.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00275.22 | 1.0 | 8 | 54.0 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 2 | PF13466.8 | 1.0 | 8 | 175.0 | same-strand | STAS domain |
| 3 | PF05494.14 | 1.0 | 8 | 484.5 | same-strand | MlaC protein |
| 4 | PF02470.22 | 1.0 | 8 | 1129.0 | same-strand | MlaD protein |
| 5 | PF02405.18 | 1.0 | 8 | 1684.5 | same-strand | Permease MlaE |
| 6 | PF00005.29 | 1.0 | 8 | 2471.5 | same-strand | ABC transporter |
| 7 | PF13365.8 | 0.88 | 7 | 2327.0 | opposite-strand | Trypsin-like peptidase domain |
| 8 | PF00089.28 | 0.88 | 7 | 2523 | opposite-strand | Trypsin |
| 9 | PF17820.3 | 0.88 | 7 | 2539.0 | opposite-strand | PDZ domain |
| 10 | PF13180.8 | 0.88 | 7 | 2327.0 | opposite-strand | PDZ domain |
| 11 | PF00595.26 | 0.88 | 7 | 2539.0 | opposite-strand | PDZ domain |
| 12 | PF06295.14 | 0.88 | 7 | 4376 | opposite-strand | Protein of unknown function (DUF1043) |
| 13 | PF03969.18 | 0.62 | 5 | 4846 | same-strand | AFG1-like ATPase |
++ More..