| Protein name |
Uncharacterized ferredoxin-like protein BU177 |
| NCBI Accession ID |
BA000003.2 |
| Organism |
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium) |
| Left |
191740 |
| Right |
192003 |
| Strand |
- |
| Nucleotide Sequence |
ATGCAATCCTCTATTATTGAAATAACAAATATTAAAAAAAAAATTGTTTATCAAACACAGATAACCTTGTTATTGGTTTTAGAATTAAACAATATTCATCTAGAATATCAATGTAGATCTGGATATTGTGGTATATGCCGAATTGAATTAATCAAAGGAGAAGTATTTTATTTAATAAAACAGCCTATGGCTGCTTTATTTAAAGAACGAGAAATTTTTCCATGTTGTTGTAAACCAAAAGGAAATATCACAATTAAAATTTAA |
| Sequence |
MQSSIIEITNIKKKIVYQTQITLLLVLELNNIHLEYQCRSGYCGICRIELIKGEVFYLIKQPMAALFKEREIFPCCCKPKGNITIKI |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl00159. Profile Description: N/A. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins. |
| Pubmed ID |
10993077
|
| Domain |
CDD:412190 |
| Functional Category |
Metal-binding |
| Uniprot ID |
P57274
|
| ORF Length (Amino Acid) |
87 |