Protein Information |
Information Type | Description |
---|---|
Protein name | Divisome-associated membrane protein Blr (Beta-lactam resistance protein) |
NCBI Accession ID | AF219227.1 |
Organism | Escherichia coli (strain K12) |
Left | 132 |
Right | 257 |
Strand | + |
Nucleotide Sequence | ATGAATCGTCTTATTGAATTAACAGGTTGGATCGTTCTTGTCGTTTCAGTCATTCTTCTTGGCGTGGCGAGTCACATTGACAACTATCAGCCACCTGAACAGAGTGCTTCGGTACAACACAAGTAA |
Sequence | MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSASVQHK |
Source of smORF | Swiss-Prot |
Function | Component of the cell division machinery, which is probably involved in the stabilization of the divisome under certain stress conditions. {ECO:0000269|Pubmed:22885295}. |
Pubmed ID | 10931331 9278503 16738553 22885295 |
Domain | CDD:380226 |
Functional Category | Others |
Uniprot ID | P56976 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1704551 | 1704676 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1681269 | 1681394 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 2304319 | 2304444 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 1918643 | 1918768 | - | NZ_CP061527.1 | Shigella dysenteriae |
5 | 1642492 | 1642617 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 2104275 | 2104400 | - | NZ_LR134340.1 | Escherichia marmotae |
7 | 1576591 | 1576716 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
8 | 446098 | 446223 | - | NZ_CP057657.1 | Escherichia fergusonii |
9 | 1536039 | 1536164 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
10 | 836311 | 836436 | - | NZ_CP038469.1 | Citrobacter tructae |
11 | 1540865 | 1541002 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
12 | 4972503 | 4972628 | - | NZ_CP033744.1 | Citrobacter freundii |
13 | 87050 | 87175 | + | NZ_CP044098.1 | Citrobacter portucalensis |
14 | 3925246 | 3925371 | - | NZ_CP053416.1 | Salmonella bongori |
15 | 1422405 | 1422542 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
16 | 56208 | 56345 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
17 | 2015627 | 2015764 | - | NZ_AP022508.1 | Enterobacter bugandensis |
18 | 2249596 | 2249733 | - | NZ_CP043318.1 | Enterobacter chengduensis |
19 | 1244924 | 1245061 | - | NZ_CP017279.1 | Enterobacter ludwigii |
20 | 2033182 | 2033319 | - | NZ_CP009756.1 | Enterobacter cloacae |
21 | 513074 | 513211 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
22 | 1959839 | 1959976 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
23 | 2041133 | 2041270 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
24 | 2566008 | 2566112 | + | NZ_CP035129.1 | Kosakonia cowanii |
25 | 1986819 | 1986956 | - | NC_015968.1 | Enterobacter soli |
26 | 1500234 | 1500371 | - | NZ_CP011602.1 | Phytobacter ursingii |
27 | 2761820 | 2761957 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
28 | 2189057 | 2189161 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
29 | 940158 | 940262 | + | NZ_CP016337.1 | Kosakonia sacchari |
30 | 2144291 | 2144395 | - | NZ_CP015113.1 | Kosakonia radicincitans |
31 | 2990531 | 2990635 | + | NZ_CP014007.2 | Kosakonia oryzae |
32 | 894440 | 894544 | + | NZ_CP045300.1 | Kosakonia arachidis |
33 | 2054025 | 2054132 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
34 | 3813190 | 3813336 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
35 | 3682611 | 3682748 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
36 | 2436191 | 2436322 | + | NZ_CP045845.1 | Kluyvera intermedia |
37 | 2646461 | 2646610 | - | NZ_CP060111.1 | Klebsiella michiganensis |
38 | 2719926 | 2720075 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
39 | 4771027 | 4771176 | + | NZ_CP026047.1 | Raoultella planticola |
40 | 2362898 | 2363047 | - | NZ_CP041247.1 | Raoultella electrica |
41 | 2499556 | 2499705 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
42 | 2561968 | 2562105 | - | NZ_CP050508.1 | Raoultella terrigena |
43 | 2384748 | 2384885 | - | NZ_CP054254.1 | Klebsiella variicola |
44 | 2302518 | 2302655 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
45 | 3306318 | 3306455 | + | NZ_CP045205.1 | Citrobacter telavivensis |
46 | 2426076 | 2426213 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
47 | 901786 | 901923 | - | NZ_CP023529.1 | Lelliottia amnigena |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02378.20 | 0.61 | 28 | 3644 | same-strand | Phosphotransferase system, EIIC |
2 | PF00367.22 | 0.63 | 29 | 3644.0 | same-strand | phosphotransferase system, EIIB |
3 | PF00155.23 | 0.72 | 33 | 2426.5 | same-strand | Aminotransferase class I and II |
4 | PF00962.24 | 0.98 | 45 | 1319.0 | same-strand | Adenosine deaminase |
5 | PF02894.19 | 0.96 | 44 | 232 | opposite-strand | Oxidoreductase family, C-terminal alpha/beta domain |
6 | PF01408.24 | 0.98 | 45 | 232.0 | opposite-strand | Oxidoreductase family, NAD-binding Rossmann fold |
7 | PF05321.13 | 0.98 | 45 | 273.0 | same-strand | Haemolysin expression modulating protein |
8 | PF10754.11 | 0.98 | 45 | 574.0 | same-strand | Protein of unknown function (DUF2569) |
9 | PF02508.16 | 1.0 | 46 | 1091 | same-strand | Rnf-Nqr subunit, membrane protein |
10 | PF14697.8 | 0.98 | 45 | 1696 | same-strand | 4Fe-4S dicluster domain |
11 | PF00037.29 | 0.98 | 45 | 1672.0 | same-strand | 4Fe-4S binding domain |
12 | PF04060.15 | 0.98 | 45 | 1672.0 | same-strand | Putative Fe-S cluster |
13 | PF12797.9 | 0.98 | 45 | 1672.0 | same-strand | 4Fe-4S binding domain |
14 | PF12837.9 | 0.98 | 45 | 1672.0 | same-strand | 4Fe-4S binding domain |
15 | PF13187.8 | 0.98 | 45 | 2203.0 | same-strand | 4Fe-4S dicluster domain |
16 | PF13237.8 | 0.98 | 45 | 2203.0 | same-strand | 4Fe-4S dicluster domain |
17 | PF01512.19 | 0.76 | 35 | 2226.5 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
18 | PF13375.8 | 0.76 | 35 | 2226.5 | same-strand | RnfC Barrel sandwich hybrid domain |
19 | PF10531.11 | 0.76 | 35 | 2226.5 | same-strand | SLBB domain |
20 | PF12838.9 | 0.8 | 37 | 2226.5 | same-strand | 4Fe-4S dicluster domain |
21 | PF13183.8 | 0.76 | 35 | 2226.5 | same-strand | 4Fe-4S dicluster domain |
22 | PF13534.8 | 0.76 | 35 | 2226.5 | same-strand | 4Fe-4S dicluster domain |