Result : P56850
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 2 |
| NCBI Accession ID | U00089.2 |
| Organism | Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
| Left | 85066 |
| Right | 85212 |
| Strand | - |
| Nucleotide Sequence | GTGCGCAAGAAGATTATCTTTGTTTGCCAAGACTGTTTAAGTAGGAACTATGTAATGTCTTGGTCGAAGCAGGTTCTTAATCGTCTTATAATTAATAAGTATTGCAAGCACTGCAACCAAAAAACCAAGCACCTCGATTCCTTTTAA |
| Sequence | MRKKIIFVCQDCLSRNYVMSWSKQVLNRLIINKYCKHCNQKTKHLDSF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 8948633 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P56850 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 85037 | 85183 | - | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 2 | 853519 | 853665 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 3 | 803253 | 803399 | - | NZ_CP059674.1 | Mycoplasma tullyi |
| 4 | 848328 | 848474 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 5 | 725864 | 726010 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 6 | 2434447 | 2434596 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 7 | 134056 | 134205 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 8 | 1400695 | 1400844 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 9 | 971343 | 971492 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 10 | 542094 | 542243 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 11 | 219833 | 219982 | + | NZ_CP013197.1 | Spiroplasma citri |
| 12 | 164841 | 164990 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 13 | 34499 | 34660 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 14 | 35923 | 36081 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 15 | 685161 | 685310 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 16 | 34273 | 34404 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 17 | 85271 | 85417 | - | NZ_LR215047.1 | Mycoplasma arthritidis |
| 18 | 195509 | 195658 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 19 | 172757 | 172906 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 20 | 33425 | 33556 | + | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 21 | 131973 | 132137 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 22 | 118248 | 118412 | + | NZ_CP024964.1 | Entomoplasma melaleucae |
| 23 | 459465 | 459614 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 24 | 526753 | 526875 | - | NZ_CP055143.1 | Mycoplasma hominis |
| 25 | 2278867 | 2279019 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 26 | 2350836 | 2350988 | - | NZ_CP065211.1 | Enterococcus lactis |
| 27 | 842529 | 842669 | - | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 28 | 704821 | 704961 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
++ More..