Result : A5I174
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein H 2 (SASP H 2) |
| NCBI Accession ID | CP000727.1 |
| Organism | Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) |
| Left | 1324705 |
| Right | 1324896 |
| Strand | - |
| Nucleotide Sequence | ATGAAATCTGAGCGTGCTAAACAAATAATAGACTCTAAAAAATATATTCCTGTTTATTACAAAAATACACCGGTTCATATAGAAAAAGTAGACAATAAAGAAAATATAGCTCATATTAAAAGTTTAAACACAGATAAAGAAATAGTTGTTAATGTAAAAACTCTTAGTGAATGTAACAAACTAAATAACTAA |
| Sequence | MKSERAKQIIDSKKYIPVYYKNTPVHIEKVDNKENIAHIKSLNTDKEIVVNVKTLSECNKLNN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl06949. Profile Description: Small acid-soluble spore protein H family. This model is derived from pfam08141 but has been expanded to include in the seed corresponding proteins from three species of Clostridium. Members of this family should occur only in endospore-forming bacteria, typically with two members per genome, but may be absent from the genomes of some endospore-forming bacteria. SspH (previously designated YfjU) was shown to be expressed specifically in spores of Bacillus subtilis. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 17519437 18060065 |
| Domain | CDD:414973 |
| Functional Category | Others |
| Uniprot ID | A5I174 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1360767 | 1360958 | - | NZ_CP028842.1 | Clostridium botulinum |
| 2 | 1368810 | 1369001 | - | NZ_CP011663.1 | Clostridium sporogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028842.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09992.11 | 1.0 | 2 | 3743.0 | opposite-strand | Phosphodiester glycosidase |
| 2 | PF04525.14 | 1.0 | 2 | 1636.0 | opposite-strand | LURP-one-related |
| 3 | PF09388.12 | 1.0 | 2 | 1604.5 | opposite-strand | Spo0E like sporulation regulatory protein |
| 4 | PF01381.24 | 1.0 | 2 | 1932.0 | same-strand | Helix-turn-helix |
| 5 | PF12844.9 | 1.0 | 2 | 1932.0 | same-strand | Helix-turn-helix domain |
| 6 | PF13443.8 | 1.0 | 2 | 1932.0 | same-strand | Cro/C1-type HTH DNA-binding domain |
| 7 | PF13560.8 | 1.0 | 2 | 1932.0 | same-strand | Helix-turn-helix domain |
| 8 | PF13303.8 | 1.0 | 2 | 2887.5 | opposite-strand | Phosphotransferase system, EIIC |
++ More..