Result : P56066
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | AE000511.1 |
| Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Left | 32405 |
| Right | 32680 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATGTATAACATACCCACCCCCACCATGGCACAAGTGATCATGGTTGATGACCCCATTACGACAACGGAATTTGTCATCTCTGCTTTGAGGGATTTTTTTGACAAGTCTTTAGAAGAGGCCAAAGCCCTTACATCAAGCATCCATCGTGATGGTGAGGGGGTTTGTGGCGTCTATCCTTATGATATTGCCAGGCATAGGGCGGCATGGGTTAGGGACAAAGCCAAAGCGTTAGAATTCCCTTTAAAATTATTGGTAGAAGAGATAAAATAA |
| Sequence | MKMYNIPTPTMAQVIMVDDPITTTEFVISALRDFFDKSLEEAKALTSSIHRDGEGVCGVYPYDIARHRAAWVRDKAKALEFPLKLLVEEIK |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | 9252185 |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | P56066 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 30262 | 30537 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 43807 | 44082 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 24945 | 25214 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 4 | 860472 | 860699 | - | NZ_CP021886.1 | Helicobacter apodemus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017379.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00180.22 | 0.75 | 3 | 1808 | same-strand | Isocitrate/isopropylmalate dehydrogenase |
| 2 | PF07509.13 | 0.75 | 3 | 1244 | same-strand | Protein of unknown function (DUF1523) |
| 3 | PF00582.28 | 0.75 | 3 | 15 | same-strand | Universal stress protein family |
| 4 | PF07724.16 | 1.0 | 4 | 0.0 | same-strand | AAA domain (Cdc48 subfamily) |
| 5 | PF00004.31 | 1.0 | 4 | 0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 6 | PF17871.3 | 1.0 | 4 | 0.0 | same-strand | AAA lid domain |
| 7 | PF10431.11 | 1.0 | 4 | 0.0 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 8 | PF07728.16 | 1.0 | 4 | 0.0 | same-strand | AAA domain (dynein-related subfamily) |
| 9 | PF02261.18 | 0.75 | 3 | 2209 | same-strand | Aspartate decarboxylase |
| 10 | PF02575.18 | 0.75 | 3 | 2570 | same-strand | YbaB/EbfC DNA-binding family |
| 11 | PF13180.8 | 0.75 | 3 | 2863 | same-strand | PDZ domain |
| 12 | PF04610.16 | 0.75 | 3 | 3866 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
++ More..