ProsmORF-pred
Result : P56052
Protein Information
Information Type Description
Protein name 50S ribosomal protein L29
NCBI Accession ID AE000511.1
Organism Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Left 1376483
Right 1376683
Strand -
Nucleotide Sequence ATGAAATATACTGAATTGAAAGATAAAAGTATCAAGGAATTAGAAGAGTTGTTGCATGCTAAAAAAGCGGAGCTTTTTGAGTTGCGCGTTAAGTTAAAGGCTATGCAATTGAGTAATCCTAACGAGATTAAGAAAGCTAGAAGAAATATCGCTCGCATTAACACGGCCATCAATGCGCATTATTCTTCTAGCGTTGAGTAA
Sequence MKYTELKDKSIKELEELLHAKKAELFELRVKLKAMQLSNPNEIKKARRNIARINTAINAHYSSSVE
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure.
Pubmed ID 9252185
Domain CDD:415815
Functional Category Ribosomal_protein
Uniprot ID P56052
ORF Length (Amino Acid) 66
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 109
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1362596 1362796 - NC_017379.1 Helicobacter pylori Puno135
2 129089 129289 + NC_008229.1 Helicobacter acinonychis str. Sheeba
3 842909 843106 - NC_017735.1 Helicobacter cetorum MIT 99-5656
4 158979 159167 + NZ_AP022847.1 Nitrosophilus alvini
5 1736960 1737154 - NZ_CP012541.1 Campylobacter concisus
6 1353536 1353727 - NZ_AP023212.1 Hydrogenimonas urashimensis
7 1850951 1851142 - NZ_AP022826.1 Nitrosophilus labii
8 1981820 1982008 - NC_013512.1 Sulfurospirillum deleyianum DSM 6946
9 2047879 2048073 - NC_018002.1 Sulfurospirillum barnesii SES-3
10 2021327 2021512 - NZ_CP012544.1 Campylobacter showae
11 68442 68627 + NZ_CP012543.1 Campylobacter rectus
12 1173460 1173666 - NZ_LS483446.1 Helicobacter mustelae
13 586085 586273 + NZ_AP018676.1 Helicobacter cinaedi
14 105237 105428 + NC_014935.1 Nitratifractor salsuginis DSM 16511
15 1249251 1249436 + NZ_CP031611.1 Campylobacter hepaticus
16 1671306 1671491 - NZ_CP053831.1 Campylobacter mucosalis
17 1782828 1783013 - NZ_CP053841.1 Campylobacter blaseri
18 91905 92090 + NZ_CP010995.1 Campylobacter iguaniorum
19 844273 844458 + NZ_CP032098.1 Malaciobacter molluscorum LMG 25693
20 1616057 1616242 - NC_002163.1 Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
21 103781 103966 + NZ_CP053828.1 Campylobacter hyointestinalis subsp. lawsonii
22 787111 787302 + NZ_CP035928.1 Malaciobacter pacificus
23 1527262 1527447 - NZ_CP015578.1 Campylobacter lanienae NCTC 13004
24 1334408 1334596 + NC_004917.1 Helicobacter hepaticus ATCC 51449
25 61309 61494 + NC_012039.1 Campylobacter lari RM2100
26 32452 32637 + NZ_CP053825.1 Campylobacter armoricus
27 70431 70616 + NZ_CP053848.1 Campylobacter ornithocola
28 694621 694806 + NZ_CP063079.1 Campylobacter peloridis
29 63690 63875 + NZ_CP007773.1 Campylobacter subantarcticus LMG 24377
30 109497 109682 + NZ_CP012547.1 Campylobacter pinnipediorum subsp. pinnipediorum
31 1268803 1268991 - NZ_LN907858.1 Helicobacter typhlonius
32 58279 58464 + NZ_CP007774.1 Campylobacter volucris LMG 24379
33 1867647 1867832 - NZ_CP035946.1 Campylobacter canadensis
34 1832299 1832484 - NZ_CP053826.1 Campylobacter curvus
35 1686825 1687010 - NZ_CP019684.1 Campylobacter sputorum bv. paraureolyticus LMG 11764
36 931935 932126 + NZ_CP019070.1 Poseidonibacter parvus
37 15291 15476 + NZ_CP020867.1 Campylobacter cuniculorum DSM 23162 = LMG 24588
38 61930 62115 + NZ_CP007770.1 Campylobacter insulaenigrae NCTC 12927
39 726745 726936 + NZ_CP031367.1 Aliarcobacter trophiarum LMG 25534
40 185873 186055 + NZ_CP012196.1 Campylobacter gracilis
41 675313 675504 + NZ_CP031217.1 Halarcobacter bivalviorum
42 611219 611410 + NZ_CP032099.1 Aliarcobacter skirrowii CCUG 10374
43 975075 975260 + NZ_CP042812.1 Malaciobacter canalis
44 946074 946259 + NZ_CP032101.1 Malaciobacter marinus
45 1576746 1576931 - NZ_CP053849.1 Campylobacter upsaliensis RM3940
46 59291 59476 + NZ_CP020478.1 Campylobacter helveticus
47 572431 572622 + NZ_CP036246.2 [Arcobacter] porcinus
48 1481896 1482087 - NZ_CP053837.1 Aliarcobacter faecis
49 37925 38110 + NZ_CP059443.1 Campylobacter fetus
50 1612831 1613022 - NZ_CP054051.1 Aliarcobacter cibarius
51 877900 878085 + NZ_CP031218.1 Malaciobacter halophilus
52 952291 952482 + NZ_CP031219.1 Malaciobacter mytili LMG 24559
53 640008 640199 + NZ_CP032823.1 Aliarcobacter cryaerophilus ATCC 43158
54 814652 814843 + NZ_CP030944.1 Arcobacter aquimarinus
55 869435 869626 + NZ_CP053833.1 Arcobacter cloacae
56 196856 197041 + NC_014762.1 Sulfuricurvum kujiense DSM 16994
57 1087935 1088126 + NC_014166.1 Arcobacter nitrofigilis DSM 7299
58 911555 911746 + NZ_CP053835.1 Arcobacter defluvii
59 1590885 1591076 - NZ_CP053842.1 Campylobacter corcagiensis
60 1612479 1612667 - NC_005090.1 Wolinella succinogenes DSM 1740
61 938204 938395 + NZ_CP032100.1 Arcobacter suis CECT 7833
62 1059491 1059682 + NZ_CP053840.1 Arcobacter venerupis
63 889268 889459 + NZ_CP032097.1 Arcobacter ellisii
64 975353 975544 + NZ_CP042652.1 Pseudoarcobacter acticola
65 950100 950291 + NZ_CP053836.1 Halarcobacter ebronensis
66 935698 935886 + NZ_CP041070.1 Arcobacter anaerophilus
67 727735 727926 + NC_017187.1 Aliarcobacter butzleri ED-1
68 173485 173673 + NZ_CP041406.1 Sulfurimonas paralvinellae
69 1394171 1394362 - NZ_CP063087.1 Helicobacter winghamensis
70 2437083 2437271 - NZ_CP017111.1 Sulfurospirillum halorespirans DSM 13726
71 215617 215805 + NC_014506.1 Sulfurimonas autotrophica DSM 16294
72 155452 155643 + NZ_CP063164.1 Sulfurovum indicum
73 661529 661723 + NZ_CP014991.1 Helicobacter himalayensis
74 2594620 2594808 - NZ_CP007201.1 Sulfurospirillum multivorans DSM 12446
75 424178 424366 + NZ_AP014724.1 Sulfurospirillum cavolei
76 1529995 1530201 - NC_012115.1 Nautilia profundicola AmH
77 2139203 2139394 + NZ_CP011308.1 Sulfurovum lithotrophicum
78 181716 181916 + NZ_CP029295.1 Mycoplasma phocidae
79 2869068 2869259 - NC_005363.1 Bdellovibrio bacteriovorus HD100
80 67923 68120 + NZ_CP021886.1 Helicobacter apodemus
81 345634 345840 + NZ_CP040463.1 Caminibacter mediatlanticus TB-2
82 1586487 1586693 - NZ_CP027432.2 Caminibacter pacificus
83 986070 986276 - NZ_CP014234.1 Moraxella osloensis
84 1302481 1302672 - NC_014810.2 Helicobacter felis ATCC 49179
85 157971 158168 - NZ_LR134343.1 Moraxella cuniculi
86 315639 315842 + NZ_CP030103.1 Mycoplasma cloacale
87 3243973 3244176 - NZ_CP040058.1 Anaerostipes rhamnosivorans
88 368542 368745 + NZ_CP036345.1 Anaerostipes caccae L1-92
89 765754 765960 + NZ_CP032364.1 Lachnoanaerobaculum umeaense
90 5613551 5613754 - NZ_CP022464.2 Enterocloster bolteae
91 336742 336951 + NZ_LN879430.1 Herbinix luporum
92 408335 408544 + NZ_AP023367.1 Anaerocolumna cellulosilytica
93 1983190 1983393 + NZ_LT990039.1 Massilistercora timonensis
94 1695263 1695454 + NZ_LS483369.1 Neisseria cinerea
95 4501071 4501280 - NC_010001.1 Lachnoclostridium phytofermentans ISDg
96 1956731 1956922 - NZ_CP072524.1 Neisseria sicca
97 387886 388071 - NZ_AP022345.1 Fluviibacter phosphoraccumulans
98 4060277 4060465 - NC_014376.1 [Clostridium] saccharolyticum WM1
99 2571319 2571525 + NZ_CP070062.1 Coprococcus comes
100 1614269 1614475 - NZ_CP027002.1 [Ruminococcus] gnavus ATCC 29149
101 1611235 1611426 + NZ_CP022347.1 Campylobacter avium LMG 24591
102 1512034 1512225 + NZ_CP072425.1 Pseudoalteromonas viridis
103 339494 339694 + NC_012778.1 [Eubacterium] eligens ATCC 27750
104 2515211 2515414 - NZ_CP022413.2 Blautia hansenii DSM 20583
105 505384 505587 + NZ_CP030280.1 Blautia argi
106 1617176 1617385 + NZ_CP048000.1 Anaerocolumna sedimenticola
107 3429698 3429901 + NZ_LT635479.1 Lachnoclostridium phocaeense
108 503965 504168 - NZ_CP036170.1 [Clostridium] scindens ATCC 35704
109 3856595 3856798 - NC_015275.1 Cellulosilyticum lentocellum DSM 5427
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_AP022847.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00673.23 0.97 106 872.0 same-strand ribosomal L5P family C-terminus
2 PF00281.21 0.99 108 872.0 same-strand Ribosomal protein L5
3 PF00467.31 0.98 107 632 same-strand KOW motif
4 PF00238.21 0.99 108 262.0 same-strand Ribosomal protein L14p/L23e
5 PF00366.22 0.99 108 11.0 same-strand Ribosomal protein S17
6 PF00252.20 0.97 106 -13.0 same-strand Ribosomal protein L16p/L10e
7 PF00189.22 1.0 109 415 same-strand Ribosomal protein S3, C-terminal domain
8 PF07650.19 0.98 107 415 same-strand KH domain
9 PF00237.21 1.0 109 1116 same-strand Ribosomal protein L22p/L17e
10 PF00203.23 0.98 107 1460 same-strand Ribosomal protein S19
11 PF03947.20 0.98 107 1748 same-strand Ribosomal Proteins L2, C-terminal domain
12 PF00181.25 0.98 107 1748 same-strand Ribosomal Proteins L2, RNA binding domain
13 PF00253.23 0.84 92 1419.0 same-strand Ribosomal protein S14p/S29e
++ More..