Result : P55914
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjjZ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 4605804 |
| Right | 4606040 |
| Strand | + |
| Nucleotide Sequence | ATGTTGCAACGTACGCTGGGCAGTGGCTGGGGAGTGTTGCTGCCGGGATTGCTGATTGCAGGGCTGATGTATGCGGATTTATCGTCAGATCAGTGGCGGATTGTCATTCTGATGGGATTAGTATTGACGCCGATGATGCTGTATCACAAACAGTTGCGGCATTACATTTTGCTACCATCGTGCCTGGCACTTATTGCTGGCATCATGCTGATGATAATGAATTTGAATCAGGGATGA |
| Sequence | MLQRTLGSGWGVLLPGLLIAGLMYADLSSDQWRIVILMGLVLTPMMLYHKQLRHYILLPSCLALIAGIMLMIMNLNQG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07256. Profile Description: Protein of unknown function (DUF1435). This family consists of several hypothetical Enterobacterial proteins of around 80 residues in length. The function of this family is unknown. |
| Pubmed ID | 7610040 9278503 16738553 |
| Domain | CDD:399912 |
| Functional Category | Others |
| Uniprot ID | P55914 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4605804 | 4606040 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4572663 | 4572899 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 5464291 | 5464527 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 3497941 | 3498177 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 3649661 | 3649897 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 4622895 | 4623128 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 592651 | 592887 | + | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 1341650 | 1341886 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 5142583 | 5142819 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 10 | 389338 | 389574 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 11 | 4810379 | 4810615 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 5148456 | 5148695 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 13 | 4874773 | 4875012 | - | NZ_CP050508.1 | Raoultella terrigena |
| 14 | 3995359 | 3995598 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 15 | 5251609 | 5251848 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 16 | 3898774 | 3899013 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 17 | 690350 | 690589 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 18 | 473246 | 473485 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 19 | 3192870 | 3193106 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 20 | 2393116 | 2393355 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 21 | 4148435 | 4148665 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 22 | 4777048 | 4777287 | - | NZ_CP054254.1 | Klebsiella variicola |
| 23 | 1650359 | 1650595 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 24 | 3164310 | 3164540 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 25 | 757982 | 758212 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 26 | 2913580 | 2913810 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 27 | 4061414 | 4061644 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 28 | 3405709 | 3405945 | + | NZ_CP033744.1 | Citrobacter freundii |
| 29 | 3772806 | 3773036 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 30 | 613471 | 613701 | + | NC_015968.1 | Enterobacter soli |
| 31 | 2711514 | 2711750 | - | NZ_CP038469.1 | Citrobacter tructae |
| 32 | 716472 | 716711 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 33 | 668565 | 668795 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 34 | 642735 | 642965 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 35 | 2469076 | 2469315 | + | NZ_CP026047.1 | Raoultella planticola |
| 36 | 4614609 | 4614848 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 37 | 2383228 | 2383467 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 38 | 647386 | 647616 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 39 | 5178170 | 5178409 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 40 | 4505437 | 4505676 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 41 | 4761999 | 4762238 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 42 | 2565730 | 2565966 | + | NZ_CP053416.1 | Salmonella bongori |
| 43 | 1883080 | 1883310 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 44 | 623263 | 623493 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 45 | 4532664 | 4532903 | - | NZ_CP041247.1 | Raoultella electrica |
| 46 | 2321829 | 2322065 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 47 | 4469970 | 4470209 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 48 | 612790 | 612993 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 49 | 3958434 | 3958673 | - | NZ_LR134201.1 | Cedecea lapagei |
| 50 | 3996049 | 3996288 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 51 | 4236388 | 4236627 | - | NZ_CP023525.1 | Cedecea neteri |
| 52 | 655233 | 655475 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 53 | 652743 | 652985 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 54 | 651300 | 651545 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 55 | 3393731 | 3393973 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 56 | 2787581 | 2787823 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 57 | 3526961 | 3527203 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 58 | 1772127 | 1772363 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 59 | 3961765 | 3962004 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 60 | 657092 | 657295 | + | NZ_CP032487.1 | Yersinia hibernica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036175.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00196.21 | 0.85 | 50 | 4410 | same-strand | Bacterial regulatory proteins, luxR family |
| 2 | PF06276.14 | 0.98 | 58 | 1420 | opposite-strand | Ferric iron reductase FhuF-like transporter |
| 3 | PF11575.10 | 0.97 | 57 | 1419.5 | opposite-strand | FhuF 2Fe-2S C-terminal domain |
| 4 | PF05175.16 | 1.0 | 59 | 524.0 | opposite-strand | Methyltransferase small domain |
| 5 | PF08468.13 | 1.0 | 59 | 524.0 | opposite-strand | Methyltransferase small domain N-terminal |
| 6 | PF13649.8 | 1.0 | 59 | 524.0 | opposite-strand | Methyltransferase domain |
| 7 | PF08242.14 | 0.98 | 58 | 524 | opposite-strand | Methyltransferase domain |
| 8 | PF08241.14 | 0.97 | 57 | 524.0 | opposite-strand | Methyltransferase domain |
| 9 | PF03603.15 | 1.0 | 59 | 1679.5 | same-strand | DNA polymerase III psi subunit |
| 10 | PF00583.27 | 0.8 | 47 | 2068.0 | same-strand | Acetyltransferase (GNAT) family |
| 11 | PF13508.9 | 0.75 | 44 | 2051 | same-strand | Acetyltransferase (GNAT) domain |
| 12 | PF00702.28 | 0.93 | 55 | 2519.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 13 | PF13242.8 | 0.88 | 52 | 2523 | same-strand | HAD-hyrolase-like |
| 14 | PF12710.9 | 0.73 | 43 | 2521.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 15 | PF16658.7 | 0.95 | 56 | 3291 | same-strand | Class II release factor RF3, C-terminal domain |
| 16 | PF00009.29 | 0.95 | 56 | 3291 | same-strand | Elongation factor Tu GTP binding domain |
| 17 | PF03144.27 | 0.95 | 56 | 3291 | same-strand | Elongation factor Tu domain 2 |
| 18 | PF01926.25 | 0.95 | 56 | 3291 | same-strand | 50S ribosome-binding GTPase |
| 19 | PF14492.8 | 0.95 | 56 | 3291 | same-strand | Elongation Factor G, domain III |
| 20 | PF13420.9 | 0.64 | 38 | 2059.0 | same-strand | Acetyltransferase (GNAT) domain |
| 21 | PF04073.17 | 0.83 | 49 | 3942 | opposite-strand | Aminoacyl-tRNA editing domain |
| 22 | PF02378.20 | 0.81 | 48 | 2259.0 | same-strand | Phosphotransferase system, EIIC |
| 23 | PF00990.23 | 0.86 | 51 | 256 | opposite-strand | Diguanylate cyclase, GGDEF domain |
++ More..