ProsmORF-pred
Result : P55698
Protein Information
Information Type Description
Protein name Putative exopolysaccharide production repressor protein y4xQ
NCBI Accession ID U00090.2
Organism Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Left 103514
Right 103816
Strand -
Nucleotide Sequence TTGTCTTTTGGTATCTTTCATCGAATTCTATGGCTGTTCCTGTGCGCCAACACTCTTATAGTCTACCTCGTAACGGGGTCCATCAGTGACGCAGTCGTCACGACTATGGTTGGTTCGCTGCTTCTGCAGCTAACTTATTTCGCAAACGTACTCTTTCTGCTCTGGCGGGCTCACTGCGCCCGGAGAGCTCGTCAAACGACCGGGCAATTCCATGGAGAGGAACAGCCGGGGGACCCTCGTATAGCGGGCACTCACGGGCGCACGGATGGGGATCCGTGCTTCGAGGACGAGGACTCTCGATAG
Sequence MSFGIFHRILWLFLCANTLIVYLVTGSISDAVVTTMVGSLLLQLTYFANVLFLLWRAHCARRARQTTGQFHGEEQPGDPRIAGTHGRTDGDPCFEDEDSR
Source of smORF Swiss-Prot
Function Could be involved in the inhibition of exopolysaccharide synthesis (EPS) and nodulation ability (nod).
Pubmed ID 9163424 19376903
Domain CDD:402598
Functional Category Others
Uniprot ID P55698
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 371726 372028 - NZ_CP029453.1 Sinorhizobium fredii CCBAU 25509
2 380515 380817 - NZ_CP023069.1 Ensifer sojae CCBAU 05684
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP029453.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01695.19 1.0 2 3029.0 opposite-strand IstB-like ATP binding protein
2 PF01609.23 1.0 2 1034.0 same-strand Transposase DDE domain
3 PF13340.8 1.0 2 1034.0 same-strand Putative transposase of IS4/5 family (DUF4096)
4 PF13586.8 1.0 2 1034.0 same-strand Transposase DDE domain
5 PF05082.15 1.0 2 306.0 same-strand Rop-like
6 PF03270.15 1.0 2 532.0 same-strand Protein of unknown function, DUF269
7 PF00148.21 1.0 2 2091.5 same-strand Nitrogenase component 1 type Oxidoreductase
8 PF11844.10 1.0 2 1273.0 same-strand Domain of unknown function (DUF3364)
++ More..