Result : P55697
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein y4xF |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 103948 |
| Right | 104124 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAGCTCGTTCGTGACCCGCCGCTTCAGCTGGTGCCGGAATATCTATTATGCATCGGCTGCGGCTGCTGACTCGGGGCGCGAGGTATGCACCTTCACGGGATCAATGACGCAGGTGAAATTCTCGGTGTTTTGCGACGCCGAGGACGATCATTCCAGCAACCAGATCATGTGA |
| Sequence | MKSSFVTRRFSWCRNIYYASAAAADSGREVCTFTGSMTQVKFSVFCDAEDDHSSNQIM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9163424 19376903 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P55697 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 372161 | 372337 | - | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
| 2 | 380950 | 381126 | - | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029453.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01609.23 | 1.0 | 2 | 1469.0 | same-strand | Transposase DDE domain |
| 2 | PF13340.8 | 1.0 | 2 | 1469.0 | same-strand | Putative transposase of IS4/5 family (DUF4096) |
| 3 | PF13586.8 | 1.0 | 2 | 1469.0 | same-strand | Transposase DDE domain |
| 4 | PF11089.10 | 1.0 | 2 | 52.0 | same-strand | Exopolysaccharide production repressor |
| 5 | PF05082.15 | 1.0 | 2 | -3.0 | same-strand | Rop-like |
| 6 | PF03270.15 | 1.0 | 2 | 223.0 | same-strand | Protein of unknown function, DUF269 |
| 7 | PF00148.21 | 1.0 | 2 | 1782.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 8 | PF11844.10 | 1.0 | 2 | 964.0 | same-strand | Domain of unknown function (DUF3364) |
| 9 | PF00142.20 | 1.0 | 2 | 4211.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 10 | PF01656.25 | 1.0 | 2 | 4211.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..