Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0437 protein y4xE |
NCBI Accession ID | U00090.2 |
Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
Left | 104121 |
Right | 104324 |
Strand | - |
Nucleotide Sequence | ATGACAGATCTTGAAGAACTCAAGCAGAGGGTTCAAAAACTGCAGTCACGCGCTGCGACTGCGAAGACGCAATTGCATGACCTTGCCGAGTGCCTTCCGAACTATTGGACCGAAATAGTGGCCGTCGCCGAAAAAACATTCGACGCTTTTGCTCAGTTGGACGCTGCCAAAAGAGAACTCGCCGCGTCGGAGAATTCACGATGA |
Sequence | MTDLEELKQRVQKLQSRAATAKTQLHDLAECLPNYWTEIVAVAEKTFDAFAQLDAAKRELAASENSR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02247. Profile Description: Rop-like. This family contains several uncharacterized bacterial proteins. These proteins are found in nitrogen fixation operons so are likely to play some role in this process. They consist of two alpha helices which are joined by a four residue linker. The helices form an antiparallel bundle and cross towards their termini. They are likely to form a rod-like dimer. They have structural similarity to the regulatory protein Rop, pfam01815. |
Pubmed ID | 9163424 19376903 |
Domain | CDD:413246 |
Functional Category | Others |
Uniprot ID | P55696 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 372334 | 372537 | - | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
2 | 381123 | 381326 | - | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
3 | 268833 | 269036 | - | NZ_CP041240.1 | Ensifer mexicanus |
4 | 456040 | 456243 | - | NZ_CP015322.1 | Mesorhizobium amorphae CCNWGS0123 |
5 | 553700 | 553903 | - | NZ_CP034999.1 | Rhizobium acidisoli |
6 | 656023 | 656223 | - | NZ_CP034999.1 | Rhizobium acidisoli |
7 | 25711 | 25911 | - | NZ_CP034999.1 | Rhizobium acidisoli |
8 | 158868 | 159071 | + | NZ_CP013109.1 | Sinorhizobium americanum |
9 | 264984 | 265187 | + | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
10 | 175510 | 175710 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
11 | 4740897 | 4741100 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
12 | 4796119 | 4796322 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
13 | 293428 | 293631 | + | NC_020061.1 | Rhizobium tropici CIAT 899 |
14 | 264553 | 264756 | + | NZ_CP032696.1 | Rhizobium jaguaris |
15 | 383646 | 383849 | - | NZ_CP013502.1 | Rhizobium esperanzae |
16 | 379962 | 380165 | - | NZ_CP013535.1 | Rhizobium phaseoli |
17 | 6713196 | 6713399 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
18 | 6661168 | 6661371 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
19 | 465345 | 465548 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
20 | 331089 | 331292 | - | NZ_CP020910.1 | Rhizobium etli |
21 | 5929636 | 5929839 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
22 | 6555347 | 6555550 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
23 | 6297222 | 6297425 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
24 | 1074084 | 1074287 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
25 | 331866 | 332069 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
26 | 5734407 | 5734607 | - | NZ_CP016428.1 | Bradyrhizobium icense |
27 | 5421737 | 5421937 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
28 | 5059980 | 5060186 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
29 | 56814 | 57011 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03270.15 | 0.71 | 17 | 25 | same-strand | Protein of unknown function, DUF269 |
2 | PF00148.21 | 0.62 | 15 | 2361 | same-strand | Nitrogenase component 1 type Oxidoreductase |
3 | PF12838.9 | 0.88 | 21 | -3 | same-strand | 4Fe-4S dicluster domain |
4 | PF13237.8 | 0.88 | 21 | -3.0 | same-strand | 4Fe-4S dicluster domain |
5 | PF12797.9 | 0.71 | 17 | -3.0 | same-strand | 4Fe-4S binding domain |
6 | PF13484.8 | 0.88 | 21 | -3 | same-strand | 4Fe-4S double cluster binding domain |
7 | PF13187.8 | 0.83 | 20 | -3.0 | same-strand | 4Fe-4S dicluster domain |
8 | PF14697.8 | 0.83 | 20 | -3.0 | same-strand | 4Fe-4S dicluster domain |
9 | PF13183.8 | 0.83 | 20 | -3.0 | same-strand | 4Fe-4S dicluster domain |