Result : P55565
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator y4mF |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 332578 |
| Right | 332808 |
| Strand | + |
| Nucleotide Sequence | ATGGCGAAGCGCATCAAAACTCCAGCCGATATCGGCGCTCTAGTCCGCATCGTGCGCAAGGAGCAAAACTTGCGGCAGGATGAGCTTGCGGGCGTTGCCGGCGTTGGCCTCCGGTTCATTGTCGATCTCGAAGCGGGCAAACCGACAGCTCAGATAGGAAAAGTGTTGCAGGTTTTGCAAACACTCGGCTGTTCGATCGATATTCTGGCTCCTGGTGAACGTAGAAAATGA |
| Sequence | MAKRIKTPADIGALVRIVRKEQNLRQDELAGVAGVGLRFIVDLEAGKPTAQIGKVLQVLQTLGCSIDILAPGERRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9163424 19376903 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | P55565 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1278635 | 1278865 | - | NZ_CP034910.1 | Ensifer alkalisoli |
| 2 | 2552392 | 2552622 | - | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 3 | 672442 | 672684 | - | NC_017957.2 | Tistrella mobilis KA081020-065 |
| 4 | 911937 | 912164 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 5 | 126137 | 126322 | - | NZ_CP009294.1 | Novosphingobium pentaromativorans US6-1 |
| 6 | 3025418 | 3025645 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 7 | 83983 | 84207 | + | NZ_CP060037.1 | Sphingobium fuliginis |
| 8 | 5709 | 5945 | - | NZ_CP009295.1 | Novosphingobium pentaromativorans US6-1 |
| 9 | 3437067 | 3437294 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 10 | 2836480 | 2836707 | + | NZ_LR134374.1 | Legionella spiritensis |
| 11 | 214462 | 214686 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 12 | 3268824 | 3269060 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 13 | 75281 | 75526 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 14 | 497400 | 497597 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 15 | 228901 | 229086 | + | NZ_CP010904.1 | Kiritimatiella glycovorans |
| 16 | 701031 | 701225 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 17 | 2749566 | 2749769 | - | NZ_CP016268.1 | Woeseia oceani |
| 18 | 589002 | 589196 | + | NZ_CP048812.1 | Halomonas socia |
| 19 | 1739060 | 1739248 | - | NZ_LR134302.1 | Achromobacter spanius |
| 20 | 1182136 | 1182348 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 21 | 959777 | 960007 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 22 | 4214718 | 4214936 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 23 | 91730 | 91963 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 24 | 2853414 | 2853611 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 25 | 2314322 | 2314567 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 26 | 3513197 | 3513439 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 27 | 279379 | 279585 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 28 | 236840 | 237046 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034910.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07804.14 | 0.77 | 20 | -3.0 | same-strand | HipA-like C-terminal domain |
| 2 | PF13657.8 | 0.81 | 21 | -3.0 | same-strand | HipA N-terminal domain |
++ More..