Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center X protein |
NCBI Accession ID | CT971583.1 |
Organism | Synechococcus sp. (strain WH7803) |
Left | 1954234 |
Right | 1954356 |
Strand | + |
Nucleotide Sequence | ATGACCCCCTCCCTCGCCAATTTCCTCAGCAGCCTGGTTTGGGGTGCAGTGATCGTGGTGGTTCCCGCCTCCATCGGCCTCTTTTTCCTGAGCCAAACCGACCGCGTCGATCGCAAACTCTGA |
Sequence | MTPSLANFLSSLVWGAVIVVVPASIGLFFLSQTDRVDRKL |
Source of smORF | Swiss-Prot |
Function | Involved in the binding and/or turnover of quinones at the Q(B) site of Photosystem II. {ECO:0000255|HAMAP-Rule:MF_01386}. |
Pubmed ID | |
Domain | CDD:420068 |
Functional Category | Others |
Uniprot ID | A5GNP1 |
ORF Length (Amino Acid) | 40 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4080144 | 4080266 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
2 | 1479618 | 1479740 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
3 | 1838190 | 1838312 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
4 | 960054 | 960173 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
5 | 48022 | 48141 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
6 | 2790002 | 2790121 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
7 | 496875 | 496994 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
8 | 1944930 | 1945049 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
9 | 4447318 | 4447440 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
10 | 2689582 | 2689701 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
11 | 7346123 | 7346242 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
12 | 3676193 | 3676312 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
13 | 580853 | 580972 | + | NZ_CP031941.1 | Nostoc sphaeroides |
14 | 4712641 | 4712760 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
15 | 1879549 | 1879662 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
16 | 5848345 | 5848464 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
17 | 2744701 | 2744820 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
18 | 5886 | 6005 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
19 | 1588938 | 1589057 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
20 | 658491 | 658610 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
21 | 5586622 | 5586741 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
22 | 3789963 | 3790082 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
23 | 3895159 | 3895281 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
24 | 1374944 | 1375063 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02786.19 | 0.67 | 16 | 661.5 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
2 | PF00289.24 | 0.67 | 16 | 661.5 | same-strand | Biotin carboxylase, N-terminal domain |
3 | PF02785.21 | 0.67 | 16 | 661.5 | same-strand | Biotin carboxylase C-terminal domain |
4 | PF02222.24 | 0.67 | 16 | 661.5 | same-strand | ATP-grasp domain |
5 | PF02325.19 | 0.75 | 18 | 212.5 | opposite-strand | YGGT family |
6 | PF07444.13 | 0.88 | 21 | 217 | same-strand | Ycf66 protein N-terminus |
7 | PF07676.14 | 0.62 | 15 | 1221.0 | same-strand | WD40-like Beta Propeller Repeat |