Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein y4kO |
NCBI Accession ID | U00090.2 |
Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
Left | 368879 |
Right | 369127 |
Strand | - |
Nucleotide Sequence | ATGACCGCTGCGTTTACCGTGCGTGTAAAAGATGAAACCGCGAGCAAGCTGGACCAGCTCGCTGAGAAGCTGGATCGGTCCCGCTCTTATATGGCTGCAGAGGCCATCGAAGCTTTCGTTGAGCAACAGGAATGGCAGCTTGCCGAGATTGAAGCCGGGTTGACCGAGGCCGACCGGGGTGAGTTCGCCAGCGATGAAGATGTGGCGAAAGTCGTCAGGAAGTACGTCAAGTCTGCCCGCCAATCATGA |
Sequence | MTAAFTVRVKDETASKLDQLAEKLDRSRSYMAAEAIEAFVEQQEWQLAEIEAGLTEADRGEFASDEDVAKVVRKYVKSARQS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22901. Profile Description: Ribbon-helix-helix protein, copG family. ParD is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is ParE in, pfam05016. The family contains several related antitoxins from Cyanobacteria, Proteobacteria and Actinobacteria. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all type II antitoxins.**The ORF matches to the profile of cl22964. Profile Description: Predicted transcriptional regulator [Transcription]. |
Pubmed ID | 9163424 19376903 |
Domain | CDD:419885,CDD:277679 |
Functional Category | Others |
Uniprot ID | P55533 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3284036 | 3284284 | - | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
2 | 125524 | 125769 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
3 | 212412 | 212642 | - | NC_020062.1 | Rhizobium tropici CIAT 899 |
4 | 214662 | 214892 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
5 | 68522 | 68746 | - | NZ_CP071606.1 | Rhizobium binae |
6 | 1972586 | 1972825 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
7 | 1558142 | 1558390 | - | NZ_CP034910.1 | Ensifer alkalisoli |
8 | 1129563 | 1129811 | - | NZ_CP034910.1 | Ensifer alkalisoli |
9 | 451074 | 451313 | - | NZ_CP046052.1 | Methylocystis heyeri |
10 | 916277 | 916528 | + | NZ_CP017147.1 | Bosea vaviloviae |
11 | 345992 | 346195 | + | NZ_CP044331.1 | Methylocystis parvus |
12 | 2420012 | 2420251 | + | NZ_CP019948.1 | Methylocystis bryophila |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05016.17 | 0.73 | 8 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |