ProsmORF-pred
Result : P55510
Protein Information
Information Type Description
Protein name Putative plasmid stability protein y4jJ
NCBI Accession ID U00090.2
Organism Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Left 394797
Right 395054
Strand -
Nucleotide Sequence ATGGCAAATGTGACCGTTAGGAACCTACCCGACGAGGTGCACCGAGCGCTACGCGTACGAGCAGCAATGCATGGCCGCAGCACCGAAGCCGAGATCCGCGACATCCTAGAAACGACTGTCCGGCCCCCGGAGCGGGTCAAACTCGGCTCTTTATTGGCGTCTATTGCCCATGAAGCTGGAGGGCTGACGGATGCCGAAGCGGAGCATTTCAACCAGCTCCGTGACAAGACTCCTGCTGAACCGATGAGCTTCGAATGA
Sequence MANVTVRNLPDEVHRALRVRAAMHGRSTEAEIRDILETTVRPPERVKLGSLLASIAHEAGGLTDAEAEHFNQLRDKTPAEPMSFE
Source of smORF Swiss-Prot
Function Involved in plasmid stability. {ECO:0000305}.
Pubmed ID 9163424 19376903
Domain
Functional Category Others
Uniprot ID P55510
ORF Length (Amino Acid) 85
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 95
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 8108 8365 - NZ_CP004389.1 Thalassospira xiamenensis M-5 = DSM 17429
2 1712127 1712384 - NZ_AP014568.1 Serpentinomonas raichei
3 898900 899157 - NZ_CP032695.1 Rhizobium jaguaris
4 3842887 3843144 - NC_008786.1 Verminephrobacter eiseniae EF01-2
5 4160527 4160781 - NC_008786.1 Verminephrobacter eiseniae EF01-2
6 2506900 2507157 + NZ_CP017476.1 Hydrogenophaga crassostreae
7 3467496 3467753 - NC_017964.1 Advenella kashmirensis WT001
8 1301078 1301332 + NZ_AP018795.1 Acidithiobacillus ferridurans
9 272715 272969 + NZ_CP071679.1 Rhizobium ruizarguesonis
10 1460556 1460813 - NZ_CP028339.1 Thauera aromatica K172
11 731812 732069 + NZ_CP039546.1 Methylorubrum populi
12 174902 175156 - NZ_CP025682.1 Azoarcus pumilus
13 18874 19131 - NC_004632.1 Pseudomonas syringae pv. tomato str. DC3000
14 199514 199753 + NZ_AP021881.1 Sulfuriferula nivalis
15 3376525 3376779 - NZ_CP011257.1 Ralstonia mannitolilytica
16 2091960 2092217 + NZ_CP045571.1 Acidithiobacillus thiooxidans ATCC 19377
17 1754874 1755131 + NZ_CP019240.1 Rhodoferax antarcticus
18 1437293 1437547 - NZ_CP023068.1 Ensifer sojae CCBAU 05684
19 294735 294974 - NZ_CP011808.2 Pandoraea faecigallinarum
20 394536 394790 + NZ_CP006880.1 Rhizobium gallicum bv. gallicum R602sp
21 3586292 3586546 + NC_019973.1 Mesorhizobium australicum WSM2073
22 2564768 2565022 - NZ_CP012621.1 Zobellella denitrificans
23 2547175 2547429 - NZ_CP012621.1 Zobellella denitrificans
24 359489 359728 + NZ_CP045236.1 Burkholderia cepacia
25 1864946 1865200 - NZ_CP004393.1 Celeribacter indicus
26 1798469 1798723 - NZ_CP004393.1 Celeribacter indicus
27 214683 214937 + NZ_CP029452.1 Sinorhizobium fredii CCBAU 25509
28 1992106 1992360 + NC_006513.1 Aromatoleum aromaticum EbN1
29 10004 10255 + NZ_CP050141.1 Komagataeibacter rhaeticus
30 410296 410547 + NZ_CP050139.1 Komagataeibacter rhaeticus
31 2035651 2035890 - NZ_CP013416.1 Burkholderia ubonensis
32 2045318 2045557 - NZ_CP013403.1 Burkholderia metallica
33 2646204 2646455 - NC_014315.1 Nitrosococcus watsonii C-113
34 2516674 2516928 - NZ_CP045434.1 Sphingomonas ginsengisoli An et al. 2013
35 2026206 2026460 + NZ_CP048812.1 Halomonas socia
36 333495 333749 - NZ_CP020909.1 Rhizobium etli
37 229853 230107 + NZ_CP071456.1 Rhizobium lentis
38 2122676 2122915 + NZ_CP011504.1 Burkholderia pyrrocinia
39 3561971 3562210 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
40 4536592 4536846 - NZ_CP060783.1 Diaphorobacter aerolatus
41 1975773 1976027 - NZ_CP013110.1 Sinorhizobium americanum
42 2570187 2570441 - NZ_CP017415.1 Acidihalobacter yilgarnenesis
43 350500 350754 + NZ_CP015882.1 Ensifer adhaerens
44 851138 851392 - NZ_CP041730.1 Chitinimonas arctica
45 2367114 2367353 - NZ_CP020738.1 Paraburkholderia acidophila
46 2503727 2503981 + NZ_CP011930.1 Herbaspirillum seropedicae
47 832207 832461 + NZ_CP028901.1 Algicoccus marinus
48 6303182 6303436 - NZ_CP041695.1 Nocardia otitidiscaviarum
49 1006769 1007008 + NC_007511.1 Burkholderia lata
50 2343209 2343463 + NZ_CP028127.1 Xanthomonas vasicola pv. vasculorum
51 2355701 2355955 - NZ_HG916765.1 Castellaniella defragrans 65Phen
52 407805 408059 - NZ_CP018839.1 Thauera chlorobenzoica
53 3558209 3558463 - NZ_CP007029.1 Thioalkalivibrio paradoxus ARh 1
54 17405 17656 + NZ_CP042811.1 Acetobacter oryzoeni
55 2398940 2399194 - NC_015942.1 Acidithiobacillus ferrivorans SS3
56 4276381 4276635 + NC_009511.1 Sphingomonas wittichii RW1
57 1314816 1315070 + NZ_CP013236.1 Collimonas pratensis
58 4851822 4852076 - NC_010524.1 Leptothrix cholodnii SP-6
59 2126858 2127097 - NZ_CP013400.1 Burkholderia seminalis
60 2895123 2895374 + NZ_CP043929.1 Methylomonas rhizoryzae
61 4549253 4549507 + NZ_CP009533.1 Pseudomonas rhizosphaerae
62 3698121 3698375 - NZ_AP019700.1 Stella humosa
63 1734276 1734515 + NZ_CP013341.1 Nitrosomonas ureae
64 1708400 1708639 + NZ_CP013341.1 Nitrosomonas ureae
65 1544009 1544263 + NC_011761.1 Acidithiobacillus ferrooxidans ATCC 23270
66 20857 21108 + NZ_CP049249.1 Rhizobium rhizoryzae
67 5759047 5759298 - NZ_LR134302.1 Achromobacter spanius
68 4997 5251 - NC_008761.1 Polaromonas naphthalenivorans CJ2
69 1345441 1345695 - NC_009719.1 Parvibaculum lavamentivorans DS-1
70 3771873 3772127 + NC_009719.1 Parvibaculum lavamentivorans DS-1
71 2069121 2069375 + NZ_LT853882.1 Xanthomonas fragariae
72 2709568 2709822 + NZ_CP023449.1 Rhizorhabdus dicambivorans
73 4389375 4389629 - NC_009937.1 Azorhizobium caulinodans ORS 571
74 2075582 2075821 - NZ_CP013452.1 Burkholderia cenocepacia
75 756155 756409 + NZ_CP048630.1 Ancylobacter pratisalsi
76 1178213 1178467 - NZ_CP051461.1 Polaromonas vacuolata
77 3139560 3139814 - NZ_CP050296.1 Mesorhizobium huakuii
78 3657429 3657668 - NZ_CP003915.1 Advenella mimigardefordensis DPN7
79 2460153 2460383 - NZ_CP003915.1 Advenella mimigardefordensis DPN7
80 561229 561483 + NZ_CP029176.1 Acidibrevibacterium fodinaquatile
81 799699 799953 + NZ_CP039288.1 Cupriavidus necator H16
82 8469993 8470247 + NZ_CP042997.1 Aquisphaera giovannonii
83 1079879 1080133 - NZ_LR134378.1 Lautropia mirabilis
84 110656 110910 - NZ_CP060037.1 Sphingobium fuliginis
85 1794539 1794793 - NZ_AP017655.1 Sphingobium cloacae
86 919822 920088 + NZ_CP029479.1 Phenylobacterium parvum
87 3705297 3705536 - NC_012560.1 Azotobacter vinelandii DJ
88 833481 833735 - NZ_AP018907.1 Blastochloris tepida
89 39917 40174 - NZ_AP023397.1 Nocardia wallacei
90 10348 10602 + NC_020453.1 Bradyrhizobium oligotrophicum S58
91 815189 815428 - NZ_AP019378.1 Bordetella parapertussis
92 2248722 2248961 - NZ_LR134326.1 Bordetella bronchiseptica
93 3225097 3225336 - NZ_AP014946.1 Variibacter gotjawalensis
94 326881 327135 - NZ_CP054022.1 Rhizobium indicum
95 5731100 5731354 + NZ_CP030053.1 Bradyrhizobium guangzhouense
96 5725565 5725810 - NZ_CP030053.1 Bradyrhizobium guangzhouense
97 5247505 5247759 - NZ_CP059082.1 Halomonas titanicae
98 1016646 1016897 + NZ_AP018724.1 Sulfurivermis fontis
99 2395339 2395572 + NZ_CP019239.1 Rhodoferax saidenbachensis
100 2994500 2994742 + NC_014217.1 Starkeya novella DSM 506
101 442054 442275 - NZ_AP019755.1 Nitrosomonas stercoris
102 5638451 5638690 + NC_016631.1 Granulicella mallensis MP5ACTX8
103 1912401 1912634 + NC_015677.1 Ramlibacter tataouinensis TTB310
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP004389.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01850.23 0.94 89 -3 same-strand PIN domain
++ More..