Result : P55424
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein y4eA |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 508261 |
| Right | 508527 |
| Strand | + |
| Nucleotide Sequence | ATGCCTCGCCCCGGTGGTTCCTACTCAACAAGCGATCTATCCCGGAAGTCCGGCGATATCATCGCCGAGGCGTTGCGCCATCCGGTCACGATCACCCAACGCAACAAGCCGCGCCTCGTCCTCCTTAACATCGACGACTACGAACGGCTGATGCGGCAATACGATGCCCGTTCAGTCGGCACACTCGAAACCCTGCCGGGCGAGCTGCTCAACGAATTCGAGGCGGCGGTGGACGCCTATGGGGAAACCGACGAGACCAATCGATGA |
| Sequence | MPRPGGSYSTSDLSRKSGDIIAEALRHPVTITQRNKPRLVLLNIDDYERLMRQYDARSVGTLETLPGELLNEFEAAVDAYGETDETNR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09153. Profile Description: Antitoxin Phd_YefM, type II toxin-antitoxin system. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other] |
| Pubmed ID | 9163424 19376903 |
| Domain | CDD:415595 |
| Functional Category | Others |
| Uniprot ID | P55424 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 53371 | 53637 | + | NZ_CP049245.1 | Rhizobium pseudoryzae |
| 2 | 213009 | 213278 | + | NZ_CP013502.1 | Rhizobium esperanzae |
| 3 | 712518 | 712787 | - | NZ_CP013504.1 | Rhizobium esperanzae |
| 4 | 197161 | 197430 | + | NZ_CP013535.1 | Rhizobium phaseoli |
| 5 | 171574 | 171843 | - | NZ_CP034999.1 | Rhizobium acidisoli |
| 6 | 646923 | 647189 | + | NZ_CP013536.1 | Rhizobium phaseoli |
| 7 | 1121313 | 1121579 | + | NZ_CP032695.1 | Rhizobium jaguaris |
| 8 | 1387169 | 1387462 | - | NZ_CP054028.1 | Rhizobium hidalgonense |
| 9 | 287305 | 287574 | - | NZ_CP020911.1 | Rhizobium etli |
| 10 | 751473 | 751742 | - | NZ_CP054022.1 | Rhizobium indicum |
| 11 | 62910 | 63185 | + | NZ_CP035002.1 | Rhizobium acidisoli |
| 12 | 484611 | 484838 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 13 | 68365 | 68619 | + | NZ_CP068420.1 | Gluconobacter sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013502.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05284.14 | 0.7 | 7 | 1471 | same-strand | Protein of unknown function (DUF736) |
| 2 | PF05406.17 | 0.7 | 7 | 1145 | opposite-strand | WGR domain |
| 3 | PF02534.16 | 0.6 | 6 | 9.0 | opposite-strand | Type IV secretory system Conjugative DNA transfer |
| 4 | PF12696.9 | 0.6 | 6 | 9.0 | opposite-strand | TraM recognition site of TraD and TraG |
| 5 | PF06412.13 | 0.6 | 6 | 1919.0 | opposite-strand | Conjugal transfer protein TraD |
| 6 | PF03389.17 | 0.6 | 6 | 2630.0 | same-strand | MobA/MobL family |
| 7 | PF13604.8 | 0.6 | 6 | 2630.0 | same-strand | AAA domain |
| 8 | PF17841.3 | 0.6 | 6 | 2630.0 | same-strand | BID domain of Bartonella effector protein (Bep) |
| 9 | PF13245.8 | 0.6 | 6 | 2630.0 | same-strand | AAA domain |
++ More..