Result : P55413
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein y4dN |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 520122 |
| Right | 520310 |
| Strand | - |
| Nucleotide Sequence | GTGGAGCGAAAGCGACTCGACGCGGAGGATCTCGTCGCCCGCATCACTTGGCAGGCGTTAAGCAAATGCCTTGTTGGAGAGATGTATGTGAATGCGGCGCGCGAGACGTTTTTCCGCACGGCGAAAAACAAGGGCCTCCTTGCCGAACCGGAGATGTCATTGAGCTCAGTTGGCCGGTTGGCTAAGTGA |
| Sequence | MERKRLDAEDLVARITWQALSKCLVGEMYVNAARETFFRTAKNKGLLAEPEMSLSSVGRLAK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9163424 19376903 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P55413 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 381375 | 381563 | + | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
| 2 | 390165 | 390353 | + | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029453.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00148.21 | 1.0 | 2 | 4923.5 | opposite-strand | Nitrogenase component 1 type Oxidoreductase |
| 2 | PF00142.20 | 1.0 | 2 | 3937.0 | opposite-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 3 | PF01656.25 | 1.0 | 2 | 3937.0 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 4 | PF13610.8 | 1.0 | 2 | 1686.0 | both-strands | DDE domain |
| 5 | PF01381.24 | 1.0 | 2 | 1605.0 | same-strand | Helix-turn-helix |
| 6 | PF13560.8 | 1.0 | 2 | 1605.0 | same-strand | Helix-turn-helix domain |
| 7 | PF12844.9 | 1.0 | 2 | 1605.0 | same-strand | Helix-turn-helix domain |
| 8 | PF07804.14 | 1.0 | 2 | 383.0 | same-strand | HipA-like C-terminal domain |
| 9 | PF13657.8 | 1.0 | 2 | 383.0 | same-strand | HipA N-terminal domain |
++ More..