Result : P55401
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable conjugal transfer protein TrbK |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 529746 |
| Right | 529943 |
| Strand | - |
| Nucleotide Sequence | GTGAGCCGCGCCGTTATCATTGCCTTAGTGATCCTCGTCGCTGCGGTTTCGACCACAGCGACAGCGCTGATCGTCAACTCCAGAGCCTCCAACCCATCCGCACCTGAGGAGCAACGCACCGCCAAAGAAAAATTCTTCGGCGCGGGGAAGGCGCTTCCGCCGATCAAGGATGGTCAGGAGATGGGTCCAAGATGGTGA |
| Sequence | MSRAVIIALVILVAAVSTTATALIVNSRASNPSAPEEQRTAKEKFFGAGKALPPIKDGQEMGPRW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02193. Profile Description: VirB5 protein family. Based on Bacteroides thetaiotaomicron gene BT_4772, a putative uncharacterized protein. As seen in gene expression experiments (http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE2231), it appears to be upregulated in the presence of host or vs when in culture. |
| Pubmed ID | 9163424 19376903 |
| Domain | CDD:413232 |
| Functional Category | Others |
| Uniprot ID | P55401 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 393639 | 393836 | - | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
| 2 | 402429 | 402626 | - | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
| 3 | 426016 | 426216 | - | NZ_CP041239.1 | Ensifer mexicanus |
| 4 | 465330 | 465530 | - | NZ_CP017943.1 | Phyllobacterium zundukense |
| 5 | 497498 | 497698 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041239.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08139.14 | 0.6 | 3 | 2689 | same-strand | Prokaryotic membrane lipoprotein lipid attachment site |
| 2 | PF03524.17 | 1.0 | 5 | 1873 | same-strand | Conjugal transfer protein |
| 3 | PF04335.15 | 1.0 | 5 | 1194 | same-strand | VirB8 protein |
| 4 | PF04610.16 | 1.0 | 5 | -6 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
| 5 | PF03135.16 | 1.0 | 5 | 772 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
| 6 | PF05101.15 | 1.0 | 5 | 3256 | same-strand | Type IV secretory pathway, VirB3-like protein |
| 7 | PF03743.16 | 0.6 | 3 | 3139 | same-strand | Bacterial conjugation TrbI-like protein |
| 8 | PF04956.15 | 0.6 | 3 | 3533 | same-strand | TrbC/VIRB2 pilin |
| 9 | PF00437.22 | 0.6 | 3 | 3909 | same-strand | Type II/IV secretion system protein |
++ More..