Result : P55397
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable conjugal transfer protein TrbD |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 533183 |
| Right | 533482 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGAGGCGCTATCCGAACGTTACCGCAATCGCATTCACCGTGCGCTCTCCCGGCCGAACCTCCTGATGGGCGCGGACCGGGAACTGGTTTTGATCACCGGGCTTGCCGCGGTCATCCTGATCTTTGTGGTGCTGACTGTCTACTCGGCGCTCTTCGGGGTTGTCGTGTGGATCGTGATCGTCGGCTTGCTCCGCATGATGGCGAAGTCCGATCCGCTGATGCGGCAGGTCTATGTCCGGCACATTTCCTACAAACCCTACTACAAGGCGACCACCTCTCCGTGGCGGCGGTATTGA |
| Sequence | MAEALSERYRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVVVWIVIVGLLRMMAKSDPLMRQVYVRHISYKPYYKATTSPWRRY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01501. Profile Description: Type IV secretory pathway, VirB3-like protein. type IV secretion system protein VirB3; Provisional |
| Pubmed ID | 9163424 19376903 |
| Domain | CDD:412928 |
| Functional Category | Others |
| Uniprot ID | P55397 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 398384 | 398683 | - | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
| 2 | 407173 | 407472 | - | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
| 3 | 141371 | 141670 | + | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 4 | 429457 | 429756 | - | NZ_CP041239.1 | Ensifer mexicanus |
| 5 | 500937 | 501236 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 6 | 536837 | 537136 | - | NZ_CP020910.1 | Rhizobium etli |
| 7 | 132651 | 132950 | + | NZ_CP071609.1 | Rhizobium binae |
| 8 | 65425 | 65724 | + | NZ_CP071458.1 | Rhizobium lentis |
| 9 | 268577 | 268876 | - | NZ_CP071615.1 | Rhizobium bangladeshense |
| 10 | 543181 | 543480 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
| 11 | 584255 | 584554 | - | NZ_CP013109.1 | Sinorhizobium americanum |
| 12 | 210339 | 210638 | - | NC_020060.1 | Rhizobium tropici CIAT 899 |
| 13 | 449361 | 449660 | - | NZ_CP041240.1 | Ensifer mexicanus |
| 14 | 544240 | 544539 | - | NZ_CP032696.1 | Rhizobium jaguaris |
| 15 | 147531 | 147815 | - | NZ_LR723671.1 | Pseudorhizobium flavum |
| 16 | 155394 | 155678 | - | NZ_CP049245.1 | Rhizobium pseudoryzae |
| 17 | 308275 | 308574 | - | NZ_CP071608.1 | Rhizobium binae |
| 18 | 249343 | 249642 | + | NZ_CP048637.1 | Rhizobium oryzihabitans |
| 19 | 23898 | 24197 | - | NC_007961.1 | Nitrobacter hamburgensis X14 |
| 20 | 54827 | 55126 | - | NC_015258.1 | Polymorphum gilvum SL003B-26A1 |
| 21 | 130502 | 130801 | - | NC_015689.1 | Afipia carboxidovorans OM5 |
| 22 | 101082 | 101381 | - | NZ_LR723673.1 | Pseudorhizobium flavum |
| 23 | 468786 | 469085 | - | NZ_CP017943.1 | Phyllobacterium zundukense |
| 24 | 88505 | 88804 | - | NZ_LT960615.1 | Hartmannibacter diazotrophicus |
| 25 | 32066 | 32323 | + | NZ_CP062809.1 | Cupriavidus basilensis |
| 26 | 20255 | 20512 | - | NZ_CP019238.1 | Rhodoferax koreense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071682.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10907.10 | 0.64 | 14 | 3240.0 | same-strand | Protein of unknown function (DUF2749) |
| 2 | PF03135.16 | 0.95 | 21 | 10 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
| 3 | PF04956.15 | 1.0 | 22 | -7.0 | same-strand | TrbC/VIRB2 pilin |
| 4 | PF00437.22 | 1.0 | 22 | 366.0 | same-strand | Type II/IV secretion system protein |
| 5 | PF00765.19 | 0.77 | 17 | 1345 | same-strand | Autoinducer synthase |
| 6 | PF13444.8 | 0.77 | 17 | 1345 | same-strand | Acetyltransferase (GNAT) domain |
| 7 | PF02195.20 | 0.68 | 15 | 3575.0 | opposite-strand | ParB-like nuclease domain |
| 8 | PF13614.8 | 0.64 | 14 | 2355 | opposite-strand | AAA domain |
| 9 | PF04610.16 | 0.77 | 17 | 3427 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
| 10 | PF04335.15 | 0.86 | 19 | 4625 | same-strand | VirB8 protein |
++ More..