Result : P55371
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein y4bD/y4pK |
| NCBI Accession ID | U00090.2 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 33989 |
| Right | 34258 |
| Strand | + |
| Nucleotide Sequence | GTGCGTATAGAGTTCGAGGTCACGCACCCGTTCCATCCGTGGCGCGGCCAGCGCTTCGTGTTGTCGACACGCAAGCAGAACTGGGGCGAGGATCGCGTCATGTTCTACGACGCGGATGGGCGGCTTCGCTCGCTGCTTGCGTCATGGACGGACGTCGCTGCACCCGATGTTTTCATTCAGATCGCGGCCGGTAGGTCGTTCGTGCGTCCAGATGATCTGGCAACCCTAGCCGCATTGATCGAGCAAATCGAGCGCAGCCATGGCGGCTGA |
| Sequence | MRIEFEVTHPFHPWRGQRFVLSTRKQNWGEDRVMFYDADGRLRSLLASWTDVAAPDVFIQIAAGRSFVRPDDLATLAALIEQIERSHGG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17342. Profile Description: Family of unknown function (DUF5372). This family of unknown function is found in Bacteria. |
| Pubmed ID | 9163424 19376903 |
| Domain | CDD:407445 |
| Functional Category | Others |
| Uniprot ID | P55371 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 181749 | 181988 | + | NZ_CP050297.1 | Mesorhizobium huakuii |
| 2 | 134458 | 134697 | + | NZ_CP050297.1 | Mesorhizobium huakuii |
| 3 | 1002208 | 1002447 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 4 | 1465105 | 1465323 | + | NC_010170.1 | Bordetella petrii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13565.8 | 1.0 | 3 | 201.0 | same-strand | Homeodomain-like domain |
| 2 | PF13518.8 | 0.67 | 2 | 199 | same-strand | Helix-turn-helix domain |
| 3 | PF13384.8 | 0.67 | 2 | 199 | same-strand | Homeodomain-like domain |
| 4 | PF00239.23 | 1.0 | 3 | 982.0 | same-strand | Resolvase, N terminal domain |
| 5 | PF07508.15 | 1.0 | 3 | 982.0 | same-strand | Recombinase |
| 6 | PF13408.8 | 1.0 | 3 | 966 | same-strand | Recombinase zinc beta ribbon domain |
| 7 | PF00665.28 | 1.0 | 3 | 3039 | opposite-strand | Integrase core domain |
| 8 | PF13333.8 | 0.67 | 2 | 19.5 | opposite-strand | Integrase core domain |
| 9 | PF01527.22 | 0.67 | 2 | 3760.0 | opposite-strand | Transposase |
++ More..