Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein y4bD/y4pK |
NCBI Accession ID | U00090.2 |
Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
Left | 33989 |
Right | 34258 |
Strand | + |
Nucleotide Sequence | GTGCGTATAGAGTTCGAGGTCACGCACCCGTTCCATCCGTGGCGCGGCCAGCGCTTCGTGTTGTCGACACGCAAGCAGAACTGGGGCGAGGATCGCGTCATGTTCTACGACGCGGATGGGCGGCTTCGCTCGCTGCTTGCGTCATGGACGGACGTCGCTGCACCCGATGTTTTCATTCAGATCGCGGCCGGTAGGTCGTTCGTGCGTCCAGATGATCTGGCAACCCTAGCCGCATTGATCGAGCAAATCGAGCGCAGCCATGGCGGCTGA |
Sequence | MRIEFEVTHPFHPWRGQRFVLSTRKQNWGEDRVMFYDADGRLRSLLASWTDVAAPDVFIQIAAGRSFVRPDDLATLAALIEQIERSHGG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17342. Profile Description: Family of unknown function (DUF5372). This family of unknown function is found in Bacteria. |
Pubmed ID | 9163424 19376903 |
Domain | CDD:407445 |
Functional Category | Others |
Uniprot ID | P55371 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 181749 | 181988 | + | NZ_CP050297.1 | Mesorhizobium huakuii |
2 | 134458 | 134697 | + | NZ_CP050297.1 | Mesorhizobium huakuii |
3 | 1002208 | 1002447 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
4 | 1465105 | 1465323 | + | NC_010170.1 | Bordetella petrii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13565.8 | 1.0 | 3 | 201.0 | same-strand | Homeodomain-like domain |
2 | PF13518.8 | 0.67 | 2 | 199 | same-strand | Helix-turn-helix domain |
3 | PF13384.8 | 0.67 | 2 | 199 | same-strand | Homeodomain-like domain |
4 | PF00239.23 | 1.0 | 3 | 982.0 | same-strand | Resolvase, N terminal domain |
5 | PF07508.15 | 1.0 | 3 | 982.0 | same-strand | Recombinase |
6 | PF13408.8 | 1.0 | 3 | 966 | same-strand | Recombinase zinc beta ribbon domain |
7 | PF00665.28 | 1.0 | 3 | 3039 | opposite-strand | Integrase core domain |
8 | PF13333.8 | 0.67 | 2 | 19.5 | opposite-strand | Integrase core domain |
9 | PF01527.22 | 0.67 | 2 | 3760.0 | opposite-strand | Transposase |