Result : P54912

Protein Information

• Protein name: Conjugal transfer protein TrbK
• NCBI Accession ID: AF242881.1
• Organism: Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
• Left: 101182
• Right: 101409
• Strand: -
• Nucleotide Sequence: GTGAGCTCGCGTCTGATCGTCATTCTCGCGCTCTTGGCCGTCGTCGCCGCAGCAAGTGCAGGCATCGGCACCTGGATTACTGTCCAGCCGGAGCCGGCCTCCGGATCTGGCGCGGCCGCGACCGATACTCCTTCGAGTGAAGAACGGCGCCGGCATCGTGATCAGTTCTTCGGCGGCGATTCGAATCGTGAAATCCGCGGCGGCCAGGAAATGAAACCGAGATGGTAG
• Sequence: MSSRLIVILALLAVVAAASAGIGTWITVQPEPASGSGAAATDTPSSEERRRHRDQFFGGDSNREIRGGQEMKPRW
• Source of smORF: Swiss-Prot
• Pubmed ID: 8763954
• Functional Category: Others
• Uniprot ID: P54912
• ORF Length (Amino Acid): 75

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	51341	51571	-	NC_015258.1	Polymorphum gilvum SL003B-26A1
2	97596	97826	-	NZ_LR723673.1	Pseudorhizobium flavum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015258.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03743.16	1.0	2	3240.5	same-strand	Bacterial conjugation TrbI-like protein
2	PF03524.17	1.0	2	1891.0	same-strand	Conjugal transfer protein
3	PF04335.15	1.0	2	1206.5	same-strand	VirB8 protein
4	PF04610.16	1.0	2	-6.0	same-strand	TrbL/VirB6 plasmid conjugal transfer protein
5	PF03135.16	1.0	2	778.0	same-strand	CagE, TrbE, VirB family, component of type IV transporter system
6	PF05101.15	1.0	2	3256.0	same-strand	Type IV secretory pathway, VirB3-like protein
7	PF04956.15	1.0	2	3548.0	same-strand	TrbC/VIRB2 pilin
8	PF00437.22	1.0	2	3942.0	same-strand	Type II/IV secretion system protein