Result : A5G1Y9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000697.1 |
| Organism | Acidiphilium cryptum (strain JF-5) |
| Left | 2941441 |
| Right | 2941716 |
| Strand | - |
| Nucleotide Sequence | ATGATCGCGAAGCATCTGATCCTGTCGGGCCGCGTCCAGGGTGTCGGGTTCCGCGACTGGATGGTGACGCGCGCCCGCCGCCTGGCCCTGGCCGGCTGGGTCCGCAACCGGGCGGACGGCACGCTCGAGGCGCTGGTCGCCGGGGATGCGCCGGCGGTCGAGGAATTGCTGCGCGCCTGCCGCCGCGGCCCGCCGCTCGCCGATGTCACCGACATCGTCGAGACCTTCGCCGAGCCGCCCGCCGAACCCGGCTTCGTCAAGCGCGCGACCGGCTAG |
| Sequence | MIAKHLILSGRVQGVGFRDWMVTRARRLALAGWVRNRADGTLEALVAGDAPAVEELLRACRRGPPLADVTDIVETFAEPPAEPGFVKRATG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A5G1Y9 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3284190 | 3284465 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 2 | 2980922 | 2981188 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 3 | 917943 | 918218 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 4 | 667365 | 667607 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 5 | 707911 | 708186 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 6 | 382076 | 382351 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 7 | 675865 | 676098 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 8 | 3083183 | 3083458 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 9 | 2627280 | 2627513 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 10 | 180883 | 181116 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 11 | 1355105 | 1355347 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 12 | 1774697 | 1774960 | + | NZ_CP041025.1 | Paremcibacter congregatus |
| 13 | 2172155 | 2172418 | + | NZ_CP017057.1 | Erythrobacter litoralis |
| 14 | 430246 | 430524 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 15 | 2043268 | 2043504 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 16 | 2641651 | 2641896 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 17 | 3129424 | 3129663 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 18 | 3357697 | 3357930 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 19 | 2672662 | 2672922 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 20 | 89292 | 89525 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 21 | 1533486 | 1533767 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 22 | 330048 | 330275 | - | NC_012804.1 | Thermococcus gammatolerans EJ3 |
| 23 | 142527 | 142802 | + | NZ_LT900021.1 | Thermococcus henrietii |
| 24 | 16694 | 16939 | - | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 25 | 293738 | 293965 | + | NZ_CP008887.1 | Thermococcus eurythermalis |
| 26 | 1825590 | 1825865 | - | NC_006624.1 | Thermococcus kodakarensis KOD1 |
| 27 | 2190657 | 2190923 | - | NZ_CP040846.1 | Thermococcus indicus |
| 28 | 1363330 | 1363596 | - | NC_011529.1 | Thermococcus onnurineus NA1 |
| 29 | 1813627 | 1813893 | - | NZ_LR881183.1 | Thermococcus camini |
| 30 | 2838930 | 2839208 | + | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 31 | 1191779 | 1192045 | + | NC_018015.1 | Thermococcus cleftensis |
| 32 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 33 | 1862234 | 1862527 | - | NZ_AP018907.1 | Blastochloris tepida |
| 34 | 1502435 | 1502674 | - | NZ_CP015881.1 | Ensifer adhaerens |
| 35 | 1569939 | 1570211 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 36 | 3108554 | 3108805 | + | NZ_CP039546.1 | Methylorubrum populi |
| 37 | 2347414 | 2347674 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 38 | 9024529 | 9024771 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 39 | 879920 | 880159 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 40 | 1005266 | 1005502 | - | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 41 | 2444551 | 2444808 | - | NZ_CP071612.1 | Rhizobium bangladeshense |
| 42 | 1974557 | 1974814 | + | NZ_CP054027.1 | Rhizobium hidalgonense |
| 43 | 1057925 | 1058164 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 44 | 1652449 | 1652694 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 45 | 235812 | 236087 | - | NZ_CP015102.1 | Thermococcus pacificus |
| 46 | 2040789 | 2041046 | - | NZ_CP034998.1 | Rhizobium acidisoli |
| 47 | 6959177 | 6959455 | + | NZ_CP036401.1 | Massilia albidiflava |
++ More..