Result : P54573
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqkK |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 268288 |
| Right | 268503 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAAAGCCAAGCGAAAAAGAAGCGGGGGCATCGATTGAGAAACGGCGGACGTGACGTCTTATTATCAAGAGGCAGCACACCATCTTTCAGCACACATGGAAGAATGACAAAAAGCAAAAAAGAGATTTTGAATAAACGGAAGCATAAGAATCCTTATGATCATACAGCAGTTGATGATAAGGATTTTTTTGTGCCCCAAAAAGCCGCCTAG |
| Sequence | MAKSQAKKKRGHRLRNGGRDVLLSRGSTPSFSTHGRMTKSKKEILNKRKHKNPYDHTAVDDKDFFVPQKAA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8501064 8969508 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P54573 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2451148 | 2451363 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2319253 | 2319468 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2310962 | 2311177 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2324073 | 2324288 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2410155 | 2410367 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3806752 | 3806973 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2247438 | 2247659 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2332907 | 2333131 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3139112 | 3139333 | + | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01676.20 | 0.89 | 8 | 2717.0 | same-strand | Metalloenzyme superfamily |
| 2 | PF00589.24 | 1.0 | 9 | 1667 | same-strand | Phage integrase family |
| 3 | PF02899.19 | 1.0 | 9 | 1667 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 4 | PF13495.8 | 1.0 | 9 | 1667 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 5 | PF14004.8 | 1.0 | 9 | 1432 | same-strand | Protein of unknown function (DUF4227) |
| 6 | PF01475.21 | 1.0 | 9 | 858 | same-strand | Ferric uptake regulator family |
| 7 | PF01944.19 | 1.0 | 9 | 101 | same-strand | Stage II sporulation protein M |
| 8 | PF00390.21 | 0.89 | 8 | 102.0 | same-strand | Malic enzyme, N-terminal domain |
| 9 | PF13291.8 | 0.67 | 6 | 102.0 | same-strand | ACT domain |
| 10 | PF03553.16 | 0.89 | 8 | 1439.5 | same-strand | Na+/H+ antiporter family |
| 11 | PF00206.22 | 0.89 | 8 | 2988.0 | same-strand | Lyase |
| 12 | PF10415.11 | 0.89 | 8 | 2988.0 | same-strand | Fumarase C C-terminus |
| 13 | PF00710.22 | 0.89 | 8 | 4461.5 | same-strand | Asparaginase, N-terminal |
| 14 | PF17763.3 | 0.89 | 8 | 4461.5 | same-strand | Glutaminase/Asparaginase C-terminal domain |
| 15 | PF01381.24 | 0.78 | 7 | 5632 | opposite-strand | Helix-turn-helix |
| 16 | PF13560.8 | 0.78 | 7 | 5632 | opposite-strand | Helix-turn-helix domain |
| 17 | PF12844.9 | 0.78 | 7 | 5632 | opposite-strand | Helix-turn-helix domain |
| 18 | PF13443.8 | 0.78 | 7 | 5632 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
++ More..