Result : P54568
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqkE |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 259148 |
| Right | 259372 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAACAAAAATCCATTGACAAACACCAGCTAAAAGACGGCCTTCAATCCGATATCAAAGCAAAGCTTATGGAGATGAAGAGCCAATTGAAGGAAGAGGATGAAAAGAGGCAGAAAAGAGAAAAAGCAGAACAGATTAGAAAGAAAAAAGAGATCGAAAAAAATAAGAGCTTTGAAGAACTCCTAAATGAAAGCCAAATGGATTGGCATCAATATAAATAA |
| Sequence | MKKQKSIDKHQLKDGLQSDIKAKLMEMKSQLKEEDEKRQKREKAEQIRKKKEIEKNKSFEELLNESQMDWHQYK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13025. Profile Description: Protein of unknown function (DUF3886). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length. There are two completely conserved L residues that may be functionally important. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:315655 |
| Functional Category | Others |
| Uniprot ID | P54568 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2460278 | 2460502 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2320097 | 2320321 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2329678 | 2329902 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2419288 | 2419512 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2333209 | 2333433 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3797599 | 3797823 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2256571 | 2256795 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2342393 | 2342617 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1657347 | 1657571 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2667817 | 2668047 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3134845 | 3135069 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2442615 | 2442848 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2543362 | 2543595 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.69 | 9 | 2939.0 | opposite-strand | Helix-turn-helix |
| 2 | PF13560.8 | 0.69 | 9 | 2939.0 | opposite-strand | Helix-turn-helix domain |
| 3 | PF12844.9 | 0.69 | 9 | 2939.0 | opposite-strand | Helix-turn-helix domain |
| 4 | PF13263.8 | 0.62 | 8 | 1766.0 | same-strand | PHP-associated |
| 5 | PF00293.30 | 0.92 | 12 | 1213.0 | same-strand | NUDIX domain |
| 6 | PF13072.8 | 0.85 | 11 | 1016 | opposite-strand | Mother cell inhibitor of FtsZ |
| 7 | PF00248.23 | 1.0 | 13 | 33 | opposite-strand | Aldo/keto reductase family |
| 8 | PF10827.10 | 1.0 | 13 | 1113 | same-strand | Protein of unknown function (DUF2552) |
| 9 | PF01521.22 | 0.85 | 11 | 1364 | same-strand | Iron-sulphur cluster biosynthesis |
| 10 | PF04229.16 | 0.77 | 10 | 1710.0 | same-strand | GrpB protein |
| 11 | PF13508.9 | 0.85 | 11 | 1725.0 | same-strand | Acetyltransferase (GNAT) domain |
| 12 | PF00326.23 | 0.62 | 8 | 158.5 | opposite-strand | Prolyl oligopeptidase family |
++ More..