Result : P54566
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqkC |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 257790 |
| Right | 258029 |
| Strand | + |
| Nucleotide Sequence | GTGGAACAAAAGCTGAAGGCAATGAAGAACACAGCACAAAATAAAACGTGGGTATCCTTCCTGAATCAAAACCATCCTTATACCTTGCTTCACTGGTCAATCGGAGGAGCAGAGTCCATCAAGAAAGATGTCTGGCTATTGCAGGATGAAATGACCTTCGAGACGCAGGAGTTTACAACGATAGATCTTGCGATTGAATGGATCAGAGAAAATATGGATGGCATTACCGACGTTCTGTAA |
| Sequence | MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10827. Profile Description: Protein of unknown function (DUF2552). This bacterial family of proteins has no known function. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:371260 |
| Functional Category | Others |
| Uniprot ID | P54566 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2461621 | 2461860 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2334449 | 2334688 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2424042 | 2424281 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2321443 | 2321682 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2334537 | 2334776 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2257906 | 2258145 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3796247 | 3796486 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1656031 | 1656270 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2343694 | 2343933 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3131964 | 3132203 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 2156027 | 2156266 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 3219594 | 3219833 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 2443958 | 2444197 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 2544704 | 2544943 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2669168 | 2669407 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 2845984 | 2846226 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 17 | 3642796 | 3643038 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 1500023 | 1500265 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 19 | 3953231 | 3953476 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 20 | 2876761 | 2877006 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 21 | 3982797 | 3983042 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 1249813 | 1250058 | + | NZ_CP040336.1 | Bacillus luti |
| 23 | 4114263 | 4114508 | - | NC_011725.1 | Bacillus cereus B4264 |
| 24 | 1943311 | 1943550 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 25 | 4122094 | 4122339 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 26 | 1577517 | 1577756 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 2419569 | 2419808 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 28 | 3290719 | 3290958 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 910276 | 910515 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 30 | 1554633 | 1554872 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 1593510 | 1593749 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 32 | 1799785 | 1800012 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 33 | 3601103 | 3601342 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 2352552 | 2352791 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00248.23 | 0.68 | 23 | 1384 | opposite-strand | Aldo/keto reductase family |
| 2 | PF13025.8 | 0.74 | 25 | 1074 | same-strand | Protein of unknown function (DUF3886) |
| 3 | PF01521.22 | 0.79 | 27 | 13 | same-strand | Iron-sulphur cluster biosynthesis |
| 4 | PF13508.9 | 0.62 | 21 | 767.0 | same-strand | Acetyltransferase (GNAT) domain |
++ More..