Result : P54558
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqjU |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2468004 |
| Right | 2468162 |
| Strand | + |
| Nucleotide Sequence | ATGAATATAGGTGATGTGATGTTTCAGCTGTTTGTATTTATTATATTTGCCGCTGTCGTCTTTGCGGCTGTTACAGGCTTCAAGTATGCGAAAAACCGAAAAGCGCAGCTGGATCGCATTGAGAAAAAGCTGAACAGCCTGTCCGAAGATCACGATTAA |
| Sequence | MNIGDVMFQLFVFIIFAAVVFAAVTGFKYAKNRKAQLDRIEKKLNSLSEDHD |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8969508 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P54558 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2468004 | 2468162 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2327892 | 2328050 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3789967 | 3790128 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2264264 | 2264425 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 1650319 | 1650486 | - | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 2349477 | 2349644 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00583.27 | 0.83 | 5 | 3936 | opposite-strand | Acetyltransferase (GNAT) family |
| 2 | PF08863.12 | 0.83 | 5 | 3410 | opposite-strand | YolD-like protein |
| 3 | PF00817.22 | 1.0 | 6 | 2176.5 | opposite-strand | impB/mucB/samB family |
| 4 | PF11799.10 | 1.0 | 6 | 2176.5 | opposite-strand | impB/mucB/samB family C-terminal domain |
| 5 | PF14164.8 | 1.0 | 6 | 1803.5 | same-strand | YqzH-like protein |
| 6 | PF00903.27 | 0.83 | 5 | -3 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 7 | PF13669.8 | 0.83 | 5 | -3 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 8 | PF00291.27 | 1.0 | 6 | 1434.5 | opposite-strand | Pyridoxal-phosphate dependent enzyme |
| 9 | PF00106.27 | 1.0 | 6 | 2828.5 | opposite-strand | short chain dehydrogenase |
| 10 | PF13561.8 | 0.67 | 4 | 2858.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 11 | PF08659.12 | 1.0 | 6 | 2828.5 | opposite-strand | KR domain |
| 12 | PF00753.29 | 1.0 | 6 | 3612.0 | opposite-strand | Metallo-beta-lactamase superfamily |
++ More..