Result : P54502
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqgY |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 154721 |
| Right | 154966 |
| Strand | - |
| Nucleotide Sequence | ATGAATCGCATGTTCCGGGTGTTAGGATTTTGGACGGGAATTTTTGCAGTCATGTTTTATTTAGGTGATATGAAAGATGCTTCCCTTTTATTTTTTGGACAGACGATCTTATTTGTGTTTCTATCGTATTTGAACTTAACCGAACGCATGTATATTTATATTTTTGGCGCTTATTTAACAATTTTCTTCGCCGGCTTTACATATTACTCAATTTTTATTATGGTGCCCGGCGGCGGAGGCCATTAA |
| Sequence | MNRMFRVLGFWTGIFAVMFYLGDMKDASLLFFGQTILFVFLSYLNLTERMYIYIFGAYLTIFFAGFTYYSIFIMVPGGGGH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11117. Profile Description: Protein of unknown function (DUF2626). This family is conserved in the Bacillaceae family. Several members are named as YqgY. The function is not known. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:378559 |
| Functional Category | Others |
| Uniprot ID | P54502 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 116
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2534090 | 2534335 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 2564638 | 2564883 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2362251 | 2362496 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 2439105 | 2439350 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2424672 | 2424917 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2437775 | 2438020 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 3692032 | 3692277 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2835166 | 2835411 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 2559977 | 2560222 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 2713340 | 2713585 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 1483444 | 1483689 | - | NZ_CP011937.1 | Bacillus velezensis |
| 12 | 2516262 | 2516507 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 13 | 3118813 | 3119055 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2256507 | 2256749 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3030413 | 3030655 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3745172 | 3745417 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 1369189 | 1369437 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 18 | 4272216 | 4272458 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 19 | 3024432 | 3024671 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 20 | 3295422 | 3295667 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 4097948 | 4098190 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 2702083 | 2702331 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 23 | 4230533 | 4230775 | + | NC_011725.1 | Bacillus cereus B4264 |
| 24 | 1660230 | 1660472 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 25 | 1134762 | 1135004 | - | NZ_CP040336.1 | Bacillus luti |
| 26 | 2516168 | 2516410 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 27 | 2073411 | 2073653 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 28 | 4063092 | 4063334 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 29 | 1906425 | 1906667 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 30 | 3018543 | 3018785 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 31 | 3344859 | 3345104 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 32 | 4487224 | 4487466 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 33 | 4113706 | 4113948 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 34 | 2607106 | 2607351 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 35 | 3529621 | 3529866 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 36 | 1740689 | 1740931 | - | NZ_LS483476.1 | Lederbergia lentus |
| 37 | 670676 | 670918 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 38 | 2945417 | 2945662 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 39 | 729785 | 730027 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 40 | 1416845 | 1417084 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 41 | 2477541 | 2477786 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 42 | 3387700 | 3387942 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 43 | 3436429 | 3436671 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 44 | 1863407 | 1863652 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 45 | 2464610 | 2464852 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 46 | 3473484 | 3473726 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 47 | 5216316 | 5216561 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 48 | 1470879 | 1471121 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 49 | 4263728 | 4263964 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 50 | 1729062 | 1729304 | + | NZ_CP016540.2 | Planococcus versutus |
| 51 | 2475822 | 2476064 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 52 | 3498930 | 3499172 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 53 | 1666960 | 1667202 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 54 | 1488489 | 1488731 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 55 | 817013 | 817255 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 56 | 1702471 | 1702713 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 57 | 1465386 | 1465628 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 58 | 1520308 | 1520550 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 59 | 1676088 | 1676330 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 60 | 28251 | 28493 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 61 | 219398 | 219640 | + | NZ_CP013661.2 | Planococcus kocurii |
| 62 | 1563232 | 1563474 | - | NZ_CP019401.1 | Planococcus faecalis |
| 63 | 1549572 | 1549814 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 64 | 1266468 | 1266710 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 65 | 1512526 | 1512768 | - | NZ_CP016538.2 | Planococcus maritimus |
| 66 | 1522834 | 1523076 | - | NZ_CP059540.1 | Planococcus maritimus |
| 67 | 1969782 | 1970027 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 68 | 1389403 | 1389630 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 69 | 1943188 | 1943430 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 70 | 2028935 | 2029177 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 71 | 2229920 | 2230162 | + | NZ_CP012024.1 | Bacillus smithii |
| 72 | 2712810 | 2713052 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 73 | 2047199 | 2047441 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 74 | 2936856 | 2937098 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 75 | 1067646 | 1067888 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 76 | 1268742 | 1268984 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 77 | 1997033 | 1997275 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 78 | 2471430 | 2471672 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 79 | 1712675 | 1712917 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 80 | 2932746 | 2932988 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 81 | 1721730 | 1721972 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 82 | 2201619 | 2201861 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 83 | 1136063 | 1136305 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 84 | 376696 | 376944 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 85 | 1975451 | 1975693 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 86 | 1336589 | 1336837 | + | NZ_CP047361.1 | Macrococcus canis |
| 87 | 1482577 | 1482825 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 88 | 188989 | 189228 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 89 | 97247 | 97489 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 90 | 1415691 | 1415930 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 91 | 1093851 | 1094099 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 92 | 1184832 | 1185080 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 93 | 1064315 | 1064560 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 94 | 2858405 | 2858638 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 95 | 2793827 | 2794063 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 96 | 5037337 | 5037567 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 97 | 2350425 | 2350691 | - | NZ_CP026363.1 | Brevibacillus agri |
| 98 | 2945792 | 2946028 | - | NZ_CP034437.1 | Paenibacillus albus |
| 99 | 1232832 | 1233068 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 100 | 1054971 | 1055234 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 101 | 4329648 | 4329884 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 102 | 4552726 | 4552962 | + | NZ_AP019400.1 | Cohnella abietis |
| 103 | 933402 | 933665 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 104 | 1699871 | 1700098 | + | NZ_CP034118.1 | Staphylospora marina |
| 105 | 2427817 | 2428053 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 106 | 855596 | 855811 | - | NZ_CP033433.1 | Cohnella candidum |
| 107 | 3389469 | 3389696 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 108 | 987812 | 988042 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 109 | 2945509 | 2945730 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 110 | 1293182 | 1293418 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 111 | 768020 | 768256 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 112 | 1100708 | 1100932 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 113 | 1457617 | 1457844 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 114 | 1760411 | 1760638 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 115 | 586155 | 586391 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 116 | 2422924 | 2423160 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 117 | 2170745 | 2170972 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT603683.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00753.29 | 0.75 | 87 | 70.5 | opposite-strand | Metallo-beta-lactamase superfamily |
| 2 | PF10958.10 | 0.73 | 85 | 874.5 | same-strand | Protein of unknown function (DUF2759) |
| 3 | PF00437.22 | 0.63 | 73 | 1031.5 | opposite-strand | Type II/IV secretion system protein |
| 4 | PF07963.14 | 0.69 | 80 | 2771 | opposite-strand | Prokaryotic N-terminal methylation motif |
++ More..