Result : P54500
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqgW |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 153715 |
| Right | 153888 |
| Strand | - |
| Nucleotide Sequence | ATGTTACTTGTCGTGATTTTCGGCCTTGTCGCTCTTTTCGCTTTATGGGGAGTCTTGCGTTCTGTTAGAAATAAAAATATACTCGGGTTTTTATTAGCCGGTGCCACCTTATTTGTCTTTGGATGGTTTACCGTGATGACCGTAATAAACAGCGGGTATCCAACCGCACATTAA |
| Sequence | MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTVMTVINSGYPTAH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10958. Profile Description: Protein of unknown function (DUF2759). This family of proteins with unknown function appear to be restricted to Bacillaceae. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:378517 |
| Functional Category | Others |
| Uniprot ID | P54500 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2565715 | 2565888 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2425747 | 2425920 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2438852 | 2439025 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2440183 | 2440356 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2535164 | 2535337 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2363328 | 2363501 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3691027 | 3691200 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2517341 | 2517514 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1482439 | 1482612 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2836239 | 2836412 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2561054 | 2561227 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2714415 | 2714588 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 2257597 | 2257770 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 3029396 | 3029569 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 3117595 | 3117768 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 1908724 | 1908864 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 17 | 674489 | 674662 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 18 | 4484673 | 4484846 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 19 | 4111303 | 4111476 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 20 | 3390426 | 3390602 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 21 | 2467226 | 2467369 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 22 | 1669692 | 1669868 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 23 | 1468365 | 1468541 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 24 | 3470967 | 3471143 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 25 | 2518923 | 2519099 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 2231464 | 2231634 | + | NZ_CP012024.1 | Bacillus smithii |
| 27 | 1485848 | 1486024 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 28 | 814638 | 814781 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 2076846 | 2077022 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 30 | 3034698 | 3034871 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 31 | 1367954 | 1368127 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 32 | 3433548 | 3433721 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 33 | 3527427 | 3527600 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 34 | 1415708 | 1415875 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 35 | 3027137 | 3027310 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 36 | 4289219 | 4289392 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 37 | 4080312 | 4080485 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 38 | 1118171 | 1118344 | - | NZ_CP040336.1 | Bacillus luti |
| 39 | 4264877 | 4265020 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 40 | 1659127 | 1659300 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 41 | 3347681 | 3347854 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 42 | 4247780 | 4247953 | + | NC_011725.1 | Bacillus cereus B4264 |
| 43 | 730856 | 731029 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 44 | 4115932 | 4116105 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 45 | 1675023 | 1675190 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 46 | 1511500 | 1511667 | - | NZ_CP016538.2 | Planococcus maritimus |
| 47 | 1521809 | 1521976 | - | NZ_CP059540.1 | Planococcus maritimus |
| 48 | 1265440 | 1265607 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 49 | 1976582 | 1976752 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 50 | 2704674 | 2704859 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011937.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11117.10 | 0.88 | 43 | 950.0 | same-strand | Protein of unknown function (DUF2626) |
| 2 | PF00753.29 | 1.0 | 49 | 171.0 | opposite-strand | Metallo-beta-lactamase superfamily |
| 3 | PF00480.22 | 0.82 | 40 | 3098.5 | opposite-strand | ROK family |
| 4 | PF06014.13 | 0.65 | 32 | 2428 | opposite-strand | Bacterial protein of unknown function (DUF910) |
++ More..