Result : P54494
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqgQ |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 147808 |
| Right | 148023 |
| Strand | + |
| Nucleotide Sequence | ATGAATACATTTTATGATGTGCAGCAGCTGTTAAAAACGTTTGGCCACATTGTTTATTTTGGAGACAGAGAGCTTGAAATTGAGTTTATGCTGGATGAATTAAAGGAATTATACATGAACCACATGATTGAAAAGGAGCAGTGGGCCAGAGCGGCAGCTGTCCTTCGAAAAGAATTGGAACAAACAAAAAACGGAAGAGATTTTTATAAAGGCTAA |
| Sequence | MNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQTKNGRDFYKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23965. Profile Description: Bacterial protein of unknown function (DUF910). This family consists of several short bacterial proteins of unknown function. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:420120 |
| Functional Category | Others |
| Uniprot ID | P54494 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2571582 | 2571797 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2446054 | 2446263 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2444727 | 2444930 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2541036 | 2541242 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2431619 | 2431828 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2369206 | 2369415 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3685113 | 3685322 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1478571 | 1478768 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2521184 | 2521381 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2721595 | 2721792 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2568244 | 2568441 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2845431 | 2845628 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3111152 | 3111355 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2264077 | 2264280 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3022860 | 3023063 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1728336 | 1728533 | + | NZ_LS483476.1 | Lederbergia lentus |
| 17 | 1072434 | 1072643 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 18 | 3353428 | 3353628 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 19 | 750829 | 751035 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 20 | 768180 | 768386 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 21 | 1513881 | 1514093 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 22 | 770417 | 770629 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 23 | 807050 | 807259 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 24 | 951365 | 951580 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 25 | 1069798 | 1070004 | + | NZ_CP043405.1 | Streptococcus ratti |
| 26 | 1065209 | 1065421 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 27 | 34878 | 35096 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 28 | 1109470 | 1109676 | - | NZ_CP013237.1 | Streptococcus mutans |
| 29 | 1592173 | 1592379 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 30 | 1959927 | 1960148 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 31 | 817040 | 817255 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00480.22 | 0.9 | 28 | 18.0 | same-strand | ROK family |
| 2 | PF01694.24 | 0.68 | 21 | 109 | same-strand | Rhomboid family |
| 3 | PF01812.22 | 0.68 | 21 | 1965 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
| 4 | PF00471.22 | 0.68 | 21 | 2612 | same-strand | Ribosomal protein L33 |
++ More..