Result : P54492
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqgO |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 145912 |
| Right | 146085 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAACTTTTGATATATGCCATTTTCGCGGTTTCTGCCGTCATGTTTTATCAAAATCGCTACCGTCTTATGAATACTGTACTCAGCCAGCCAGGAATCAGGCGGTCTTTTATCCATTTGTTTTTAAGAATTCCATTTATCCGCAATAAGTTTATACAGCAAGCTTTCTAA |
| Sequence | MKKLLIYAIFAVSAVMFYQNRYRLMNTVLSQPGIRRSFIHLFLRIPFIRNKFIQQAF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8969508 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P54492 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2573520 | 2573693 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2446639 | 2446812 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2433554 | 2433727 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2447988 | 2448161 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3683201 | 3683374 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2542964 | 2543137 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2371155 | 2371328 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1476748 | 1476921 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2523032 | 2523205 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2725059 | 2725232 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2571707 | 2571880 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2848891 | 2849064 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00246.26 | 0.67 | 8 | 5030.0 | same-strand | Zinc carboxypeptidase |
| 2 | PF00884.25 | 0.83 | 10 | 3041.5 | same-strand | Sulfatase |
| 3 | PF00480.22 | 1.0 | 12 | 1952.5 | same-strand | ROK family |
| 4 | PF06014.13 | 0.83 | 10 | 1724.0 | same-strand | Bacterial protein of unknown function (DUF910) |
| 5 | PF01694.24 | 0.83 | 10 | 89.5 | same-strand | Rhomboid family |
| 6 | PF14559.8 | 0.83 | 10 | 89.5 | same-strand | Tetratricopeptide repeat |
| 7 | PF13432.8 | 0.83 | 10 | 89.5 | same-strand | Tetratricopeptide repeat |
| 8 | PF13431.8 | 0.75 | 9 | 89 | same-strand | Tetratricopeptide repeat |
| 9 | PF01812.22 | 1.0 | 12 | 67.0 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
| 10 | PF00471.22 | 1.0 | 12 | 711.0 | same-strand | Ribosomal protein L33 |
| 11 | PF00534.22 | 0.75 | 9 | 948 | same-strand | Glycosyl transferases group 1 |
| 12 | PF13692.8 | 0.75 | 9 | 948 | same-strand | Glycosyl transferases group 1 |
| 13 | PF02685.18 | 0.67 | 8 | 1956.0 | same-strand | Glucokinase |
++ More..