| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqfZ |
| NCBI Accession ID | AF421961.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 205 |
| Right | 504 |
| Strand | - |
| Nucleotide Sequence | ATGAAGCGTCTCACCTTAGTATGCAGCATTGTTTTTATACTTTTTATTCTTTTTTATGACCTTAAAATTGGAACCATACCCATTCAGGACCTCCCTGTCTATGAAGCATCAGCAAAAACGGCTGTACAAGAACCGGCTTATAAAACGGTGAAGGTAAAGCCGGGTGATACGGTTATGTCGATAGTCGGATCAGCAGGTTCTCCGGATGACATTGTAAAGGATTTTGAAGCACTGAATCCAAATGTGAAAGCTAACGCCATTCAAGCCGGAACAGCGTATAAATTCCCGGTCTACCCTTAA |
| Sequence | MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEPAYKTVKVKPGDTVMSIVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21525. Profile Description: Lysin Motif is a small domain involved in binding peptidoglycan. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:419709 |
| Functional Category | Others |
| Uniprot ID | P54483 |
| ORF Length (Amino Acid) | 99 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2588701 | 2589000 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2460796 | 2461095 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2462145 | 2462444 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2447712 | 2448011 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2557109 | 2557408 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3668898 | 3669197 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2385330 | 2385629 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2535781 | 2536083 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1463869 | 1464171 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2745205 | 2745510 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2279955 | 2280257 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 3006672 | 3006974 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 3095428 | 3095730 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2586108 | 2586413 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 2861891 | 2862199 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02777.20 | 1.0 | 15 | 1663 | opposite-strand | Iron/manganese superoxide dismutases, C-terminal domain |
| 2 | PF00081.24 | 1.0 | 15 | 1663 | opposite-strand | Iron/manganese superoxide dismutases, alpha-hairpin domain |
| 3 | PF04306.15 | 1.0 | 15 | 1001 | opposite-strand | Protein of unknown function (DUF456) |
| 4 | PF06691.13 | 1.0 | 15 | 95 | same-strand | Protein of unknown function (DUF1189) |
| 5 | PF04551.16 | 1.0 | 15 | 124 | same-strand | GcpE protein |
| 6 | PF01475.21 | 1.0 | 15 | 2427 | opposite-strand | Ferric uptake regulator family |
| 7 | PF02588.17 | 0.6 | 9 | 3003 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 8 | PF10035.11 | 0.6 | 9 | 3003 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 9 | PF00905.24 | 0.8 | 12 | 3770.5 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 10 | PF03717.17 | 0.8 | 12 | 3770.5 | opposite-strand | Penicillin-binding Protein dimerisation domain |