Result : P54477
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqfT |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 126351 |
| Right | 126605 |
| Strand | - |
| Nucleotide Sequence | ATGATTTTATTTCAAAGAATTATTTTGCAGCGGCTTAATCAGGCTACTGCTGATGATTTGCTGAAGTACTCAAAACAATACGGAATCAGCTTAACAAGATCGCAGGCCGTTGAAGTAGCGAACCTGTTATACGGGAAAAATGTAAACATCTTTAATGAGAGTGAACGAATGCGGCTGCTGAAACAAGTAGAGACGATTACATCGAAAGAAACAGCTCAAACAGTTAATGAACTATTCAAACAATTTACAAGCTAA |
| Sequence | MILFQRIILQRLNQATADDLLKYSKQYGISLTRSQAVEVANLLYGKNVNIFNESERMRLLKQVETITSKETAQTVNELFKQFTS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11116. Profile Description: Protein of unknown function (DUF2624). This family is conserved in the Bacillaceae family. Several members are named as YqfT. The function is not known. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:402612 |
| Functional Category | Others |
| Uniprot ID | P54477 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2593000 | 2593254 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2452010 | 2452264 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2561395 | 2561649 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2466446 | 2466700 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2465105 | 2465359 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3664639 | 3664893 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2389630 | 2389884 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1459673 | 1459927 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2540027 | 2540281 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3088488 | 3088742 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 2999775 | 3000029 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2287096 | 2287350 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 2751136 | 2751390 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 2592041 | 2592295 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 2867811 | 2868071 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04551.16 | 0.6 | 9 | 2744 | same-strand | GcpE protein |
| 2 | PF01475.21 | 1.0 | 15 | 1140 | opposite-strand | Ferric uptake regulator family |
| 3 | PF02588.17 | 1.0 | 15 | 119 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 4 | PF10035.11 | 1.0 | 15 | 119 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 5 | PF01261.26 | 1.0 | 15 | 30 | opposite-strand | Xylose isomerase-like TIM barrel |
| 6 | PF00270.31 | 1.0 | 15 | 934 | opposite-strand | DEAD/DEAH box helicase |
| 7 | PF00271.33 | 1.0 | 15 | 934 | opposite-strand | Helicase conserved C-terminal domain |
| 8 | PF04851.17 | 0.87 | 13 | 934 | opposite-strand | Type III restriction enzyme, res subunit |
| 9 | PF14181.8 | 0.87 | 13 | 2420 | same-strand | YqfQ-like protein |
| 10 | PF02401.20 | 1.0 | 15 | 3272 | same-strand | LytB protein |
| 11 | PF01784.20 | 1.0 | 15 | 4239 | opposite-strand | NIF3 (NGG1p interacting factor 3) |
++ More..