Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YrkS |
NCBI Accession ID | D84432.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 17468 |
Right | 17632 |
Strand | + |
Nucleotide Sequence | ATGAAGGTAATAATCATCGAGGGACTGCAAACTGACAAATGCATGAACGATTGCTATCATTATTTAATAAAACTTTATAGGCAGGAGATCCAGGGTGATAGCAATATATCGTGGAACAAGCGATCAAGGGATCGAGCATCGACAGCCAGATCGAGGCCTGTATAA |
Sequence | MKVIIIEGLQTDKCMNDCYHYLIKLYRQEIQGDSNISWNKRSRDRASTARSRPV |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 3125151 8969508 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | P54446 |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2701979 | 2702143 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2450755 | 2450925 | - | NZ_CP051464.1 | Bacillus mojavensis |
3 | 2513069 | 2513251 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 3603564 | 3603758 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 3565413 | 3565568 | + | NZ_CP029364.1 | Bacillus halotolerans |
6 | 2531922 | 2532092 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04545.18 | 0.8 | 4 | 280.5 | opposite-strand | Sigma-70, region 4 |
2 | PF03446.17 | 0.6 | 3 | 2716 | same-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
3 | PF14040.8 | 0.6 | 3 | 1215 | same-strand | Deoxyribonuclease NucA/NucB |
4 | PF04542.16 | 0.6 | 3 | 310 | opposite-strand | Sigma-70 region 2 |
5 | PF03807.19 | 0.6 | 3 | 2470 | same-strand | NADP oxidoreductase coenzyme F420-dependent |