Result : P54436
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative sulfur carrier protein YrkI |
| NCBI Accession ID | D84432.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8536 |
| Right | 8763 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCAGATAAAGTATTAGACGCAAAAGGCTTGGCATGCCCAATGCCAATTGTCAGAACAAAAAAAGCGATGAATGAACTGGAATCAGGTCAAATATTAGAAGTGCATGCAACAGATAAGGGAGCCAAAAATGATCTTACAGCCTGGTCTAAATCAGGCGGACATGACCTTTTAGAGCAAACGGACGAGGGCGATATATTGAAATTTTGGATTCAAAAAGGCTAA |
| Sequence | MKSDKVLDAKGLACPMPIVRTKKAMNELESGQILEVHATDKGAKNDLTAWSKSGGHDLLEQTDEGDILKFWIQKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00436. Profile Description: N/A. Members of this family of hypothetical bacterial proteins have no known function. |
| Pubmed ID | 8969508 9384377 |
| Domain | CDD:412376 |
| Functional Category | Others |
| Uniprot ID | P54436 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 116
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2710848 | 2711075 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3411986 | 3412213 | - | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 533416 | 533643 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 4 | 727733 | 727960 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2521954 | 2522181 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2454409 | 2454636 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3217770 | 3217994 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 8 | 3221048 | 3221275 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 9 | 67378 | 67605 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 10 | 350333 | 350560 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 11 | 4246300 | 4246527 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 12 | 354309 | 354536 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 13 | 2152178 | 2152405 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 14 | 4251775 | 4252002 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 15 | 345419 | 345646 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 16 | 3758561 | 3758788 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 17 | 2248850 | 2249077 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 18 | 4738213 | 4738440 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 19 | 493702 | 493929 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 20 | 2680287 | 2680514 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 21 | 437504 | 437734 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 22 | 2858708 | 2858935 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 23 | 41951 | 42178 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 24 | 1063986 | 1064213 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 25 | 393410 | 393637 | + | NZ_LS483476.1 | Lederbergia lentus |
| 26 | 4116249 | 4116479 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 27 | 4120891 | 4121073 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 28 | 1409443 | 1409673 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 29 | 1439214 | 1439444 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 30 | 1034584 | 1034811 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 31 | 1334118 | 1334345 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 32 | 1887165 | 1887392 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 33 | 3002336 | 3002563 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 34 | 2829321 | 2829548 | - | NZ_CP016538.2 | Planococcus maritimus |
| 35 | 372021 | 372248 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 36 | 448941 | 449168 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 37 | 2253356 | 2253583 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 38 | 2778354 | 2778581 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 39 | 4174134 | 4174361 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 40 | 425106 | 425333 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 41 | 428474 | 428701 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 42 | 207083 | 207313 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 43 | 2479338 | 2479565 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 44 | 1500925 | 1501152 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 45 | 2658354 | 2658581 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 46 | 1332435 | 1332665 | - | NZ_CP043404.1 | Bacillus safensis |
| 47 | 2850288 | 2850515 | - | NZ_CP059540.1 | Planococcus maritimus |
| 48 | 1292461 | 1292688 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 49 | 369049 | 369276 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 50 | 274752 | 274979 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 51 | 2717610 | 2717837 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 52 | 3899371 | 3899598 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 53 | 2889821 | 2890048 | - | NZ_CP016540.2 | Planococcus versutus |
| 54 | 2214186 | 2214413 | + | NZ_CP013661.2 | Planococcus kocurii |
| 55 | 515671 | 515898 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 56 | 1278212 | 1278439 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 57 | 2994308 | 2994535 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 58 | 2885741 | 2885968 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 59 | 3233532 | 3233759 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 60 | 3060045 | 3060272 | - | NZ_CP019401.1 | Planococcus faecalis |
| 61 | 3695740 | 3695967 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 62 | 1846757 | 1846984 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 63 | 438179 | 438406 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 64 | 2891076 | 2891303 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 65 | 2905858 | 2906085 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 66 | 2909102 | 2909329 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 67 | 836204 | 836431 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 68 | 2112247 | 2112474 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 69 | 1116547 | 1116774 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 70 | 289852 | 290034 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 71 | 783466 | 783693 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 72 | 3930818 | 3931045 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 73 | 4439178 | 4439405 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 74 | 171364 | 171591 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 75 | 281605 | 281835 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 76 | 341240 | 341467 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 77 | 2580270 | 2580497 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 78 | 370525 | 370752 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 79 | 3283783 | 3284010 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 80 | 3280524 | 3280751 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 81 | 3534153 | 3534380 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 82 | 3618729 | 3618956 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 83 | 785482 | 785709 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 84 | 1658419 | 1658646 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 85 | 2875014 | 2875241 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 86 | 1300989 | 1301216 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 87 | 595053 | 595280 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 88 | 4334814 | 4335041 | - | NZ_CP040336.1 | Bacillus luti |
| 89 | 4334562 | 4334789 | - | NZ_CP040336.1 | Bacillus luti |
| 90 | 804616 | 804843 | + | NC_011725.1 | Bacillus cereus B4264 |
| 91 | 375894 | 376121 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 92 | 961776 | 962003 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 93 | 934186 | 934413 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 94 | 965020 | 965247 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 95 | 2517845 | 2518072 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 96 | 797632 | 797859 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 97 | 184896 | 185078 | + | NZ_CP034437.1 | Paenibacillus albus |
| 98 | 931737 | 931964 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 99 | 795771 | 795998 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 100 | 47348 | 47575 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 101 | 4339908 | 4340135 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 102 | 403718 | 403945 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 103 | 4029258 | 4029440 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 104 | 429031 | 429258 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 105 | 3037515 | 3037742 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 106 | 484478 | 484660 | - | NZ_CP026363.1 | Brevibacillus agri |
| 107 | 92832 | 93014 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 108 | 1713794 | 1714030 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 109 | 2197674 | 2197856 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 110 | 49087 | 49314 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 111 | 1429401 | 1429583 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 112 | 1262385 | 1262621 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 113 | 25560 | 25769 | + | NZ_CP007028.1 | Thermocrinis ruber |
| 114 | 2273706 | 2273936 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 115 | 128849 | 129031 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 116 | 1660391 | 1660573 | + | NZ_CP053989.1 | Niallia circulans |
| 117 | 2473424 | 2473654 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 118 | 264847 | 265086 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 119 | 4236952 | 4237134 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 120 | 102411 | 102593 | - | NC_015562.1 | Methanotorris igneus Kol 5 |
| 121 | 1138336 | 1138518 | - | NZ_CP009149.1 | Methanocaldococcus bathoardescens |
| 122 | 520985 | 521215 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 123 | 989413 | 989595 | - | NC_009635.1 | Methanococcus aeolicus Nankai-3 |
| 124 | 1270433 | 1270660 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 125 | 4230854 | 4231090 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 126 | 5005778 | 5006014 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 127 | 4140826 | 4141062 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 128 | 4104423 | 4104659 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 129 | 2618482 | 2618709 | - | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 130 | 1399273 | 1399500 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 131 | 3392684 | 3392878 | - | NZ_CP072793.1 | Thiothrix unzii |
| 132 | 1272449 | 1272676 | - | NZ_CP060783.1 | Diaphorobacter aerolatus |
| 133 | 3283135 | 3283365 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 134 | 2048457 | 2048687 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 135 | 3934809 | 3935039 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 136 | 2111085 | 2111297 | + | NZ_LT907988.1 | Orrella dioscoreae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01925.21 | 0.6 | 70 | 61.0 | same-strand | Sulfite exporter TauE/SafE |
| 2 | PF00753.29 | 0.73 | 85 | 63 | same-strand | Metallo-beta-lactamase superfamily |
| 3 | PF00581.22 | 0.79 | 92 | 1228.0 | same-strand | Rhodanese-like domain |
| 4 | PF01206.19 | 0.71 | 82 | 1247 | same-strand | Sulfurtransferase TusA |
| 5 | PF13686.8 | 0.74 | 86 | 1437.5 | same-strand | DsrE/DsrF/DrsH-like family |
| 6 | PF02635.17 | 0.79 | 92 | 1214 | same-strand | DsrE/DsrF-like family |
++ More..