Result : P54426
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbxH (ORF3) |
| NCBI Accession ID | X92859.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 753 |
| Right | 944 |
| Strand | + |
| Nucleotide Sequence | ATGGGAGCAATTGAACGAAGCGGATATACATTTCAGCCGGAGTTTAGCGTTGTCCGTCAAAACGGAGCCATCCATGTGTACCATCAAGGAGAATTTGTGGAAGAAATCGAATTTGAATTTAACGGGGAATATCCCGATCATGATTTGATTGAAGAGCTTGTGAATCATTATTGTTTTGAGCATGAGATTTAG |
| Sequence | MGAIERSGYTFQPEFSVVRQNGAIHVYHQGEFVEEIEFEFNGEYPDHDLIEELVNHYCFEHEI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17340. Profile Description: Family of unknown function (DUF5370). This is a family of unknown function found in Bacillaceae. |
| Pubmed ID | 9016963 9384377 |
| Domain | CDD:407444 |
| Functional Category | Others |
| Uniprot ID | P54426 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 228331 | 228522 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 222428 | 222619 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 189505 | 189696 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 363718 | 363909 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 219532 | 219723 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 6 | 207909 | 208100 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 7 | 245910 | 246101 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 8 | 230169 | 230360 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 9 | 221488 | 221679 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 2442189 | 2442380 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 11 | 2010492 | 2010692 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 12 | 1879269 | 1879460 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 13 | 4421909 | 4422100 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 14 | 1239709 | 1239900 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 15 | 1495204 | 1495410 | + | NZ_CP012024.1 | Bacillus smithii |
| 16 | 3953683 | 3953874 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 17 | 141920 | 142120 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 18 | 2934430 | 2934630 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 19 | 1046051 | 1046248 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 20 | 2329121 | 2329318 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 21 | 490829 | 491026 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 22 | 2952382 | 2952576 | + | NZ_CP070511.1 | Parageobacillus toebii |
++ More..