Result : P54395
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpmA |
| NCBI Accession ID | L47709.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 18437 |
| Right | 18607 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAGTAAAATCGAAATTCTTTCAACAATTAATGTAGAGCATTCTGATGATCTGTATAAAATTGTGGACACATTGAATCGTACACTGAAAAGAGACAATCTGATGTTCGGCCTTGCGCTGGATGAAGAAAACAAAAACCAAGCCGTTTTTACCATTTATCGTACGTAG |
| Sequence | MESKIEILSTINVEHSDDLYKIVDTLNRTLKRDNLMFGLALDEENKNQAVFTIYRT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14084. Profile Description: Protein of unknown function (DUF4264). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. |
| Pubmed ID | 8760912 9384377 |
| Domain | CDD:404892 |
| Functional Category | Others |
| Uniprot ID | P54395 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2147279 | 2147449 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 2 | 2218640 | 2218810 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3907117 | 3907287 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2349358 | 2349528 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 2158501 | 2158671 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2306547 | 2306717 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2221459 | 2221629 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1766327 | 1766497 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2233437 | 2233607 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1733484 | 1733654 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 11 | 1040238 | 1040408 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 12 | 2320087 | 2320257 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2422254 | 2422424 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 3159792 | 3159962 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 15 | 1708129 | 1708299 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 16 | 1429761 | 1429931 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 17 | 2218846 | 2219016 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 18 | 69701 | 69871 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 19 | 3747482 | 3747652 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 20 | 1623159 | 1623329 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 2543988 | 2544158 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 22 | 3241054 | 3241224 | + | NZ_CP043404.1 | Bacillus safensis |
| 23 | 3332160 | 3332330 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 24 | 2047594 | 2047764 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 25 | 3530623 | 3530793 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 26 | 1790950 | 1791120 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 27 | 1678573 | 1678743 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 28 | 1376450 | 1376620 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 29 | 2035478 | 2035648 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 30 | 4690111 | 4690281 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 3087262 | 3087432 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 32 | 463565 | 463735 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 2291067 | 2291237 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 34 | 1849583 | 1849753 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 35 | 1822563 | 1822733 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 36 | 2288755 | 2288925 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 37 | 3666176 | 3666346 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 38 | 3121368 | 3121538 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 39 | 3740376 | 3740546 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 40 | 3609344 | 3609514 | - | NZ_CP040336.1 | Bacillus luti |
| 41 | 1476021 | 1476191 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 42 | 1526020 | 1526190 | + | NC_011725.1 | Bacillus cereus B4264 |
| 43 | 3093561 | 3093731 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 44 | 4326656 | 4326826 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 45 | 2330657 | 2330827 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 46 | 1707869 | 1708039 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 47 | 1835581 | 1835754 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 48 | 2185623 | 2185793 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 49 | 2243214 | 2243384 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 50 | 1477044 | 1477214 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 51 | 2053377 | 2053547 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 52 | 1942792 | 1942962 | - | NZ_CP016540.2 | Planococcus versutus |
| 53 | 1367537 | 1367707 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 54 | 1493335 | 1493505 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 55 | 2001017 | 2001187 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 56 | 1801979 | 1802149 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 57 | 1578176 | 1578346 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 58 | 2022831 | 2023001 | - | NZ_CP012024.1 | Bacillus smithii |
| 59 | 3170269 | 3170439 | + | NZ_CP013661.2 | Planococcus kocurii |
| 60 | 2041730 | 2041900 | - | NZ_CP019401.1 | Planococcus faecalis |
| 61 | 1946834 | 1947004 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 62 | 2211340 | 2211510 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 63 | 2505737 | 2505907 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 64 | 1528297 | 1528467 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 65 | 1824392 | 1824562 | - | NZ_CP016538.2 | Planococcus maritimus |
| 66 | 1830160 | 1830330 | - | NZ_CP059540.1 | Planococcus maritimus |
| 67 | 1737399 | 1737569 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 68 | 1581351 | 1581500 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 69 | 1767164 | 1767334 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 70 | 1896818 | 1896958 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 71 | 1483433 | 1483618 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 72 | 3649586 | 3649753 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00730.27 | 0.96 | 67 | 3932 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 2 | PF00633.25 | 0.96 | 67 | 3932 | same-strand | Helix-hairpin-helix motif |
| 3 | PF10576.11 | 0.61 | 43 | 3939.5 | same-strand | Iron-sulfur binding domain of endonuclease III |
| 4 | PF07261.13 | 0.96 | 67 | 3207 | same-strand | Replication initiation and membrane attachment |
| 5 | PF00152.22 | 0.84 | 59 | 1830 | same-strand | tRNA synthetases class II (D, K and N) |
| 6 | PF01336.27 | 0.84 | 59 | 1830 | same-strand | OB-fold nucleic acid binding domain |
| 7 | PF00155.23 | 0.9 | 63 | 513.5 | same-strand | Aminotransferase class I and II |
| 8 | PF17881.3 | 0.96 | 67 | 9.0 | same-strand | Domain of unknown function (DUF5590) |
| 9 | PF00929.26 | 0.97 | 68 | 170.5 | same-strand | Exonuclease |
| 10 | PF13307.8 | 0.99 | 69 | 170.5 | same-strand | Helicase C-terminal domain |
| 11 | PF04851.17 | 0.93 | 65 | 159.0 | same-strand | Type III restriction enzyme, res subunit |
| 12 | PF02261.18 | 0.96 | 67 | 3109 | same-strand | Aspartate decarboxylase |
| 13 | PF02569.17 | 0.96 | 67 | 3479.5 | same-strand | Pantoate-beta-alanine ligase |
| 14 | PF02548.17 | 0.8 | 56 | 4378.5 | same-strand | Ketopantoate hydroxymethyltransferase |
| 15 | PF03099.21 | 0.71 | 50 | 5386 | same-strand | Biotin/lipoate A/B protein ligase family |
| 16 | PF08279.14 | 0.71 | 50 | 5386 | same-strand | HTH domain |
| 17 | PF02237.19 | 0.69 | 48 | 5387 | same-strand | Biotin protein ligase C terminal domain |
++ More..