Result : P54379
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sigma-G-dependent sporulation-specific SASP protein |
| NCBI Accession ID | X92859.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 488 |
| Right | 736 |
| Strand | + |
| Nucleotide Sequence | ATGGATGTTACACTCGGTTATTTGCGCGAATCACTTTCGAATCATCTAGAAAATGAAGTCTGCCAGCGTATTTGCAAGAAGATGCTGGCGAAGCGTTATGCAAATGAAGAGGAATTTGTAAAAGACTTAGATGATAATGAAATGTCTTTTTTGAACCATGTATTAGAAAAAGAAATTAAGTATGCCCAGAATGAACAGGATCAAAAACGGGCCAAGGAATTAAACGAGGTGTATGAATTACTGCTTTGA |
| Sequence | MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDDNEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17334. Profile Description: Sigma-G-dependent sporulation-specific SASP protein. Curli are extracellular functional amyloids that are assembled by enteric bacteria during biofilm formation and host colonization. The csg (curli specific gene) operon encodes major structural and accessory proteins that are required for curli production. The csgBAC operon encodes the major and minor curli fiber components, CsgA and CsgB, respectively. CsgA is secreted to the extracellular milieu as an unfolded protein and forms amyloid polymers upon interacting with the CsgB nucleator. CsgA is comprised of five imperfect repeating units with highly conserved glutamine and asparagine residues that are important for amyloid formation. Each repeating unit is predicted to form a strand-loop-strand motif. In vitro, CsgC inhibits CsgA amyloid formation at substoichiometric concentrations and maintains CsgA in a non-beta-sheet rich conformation, making CsgC an efficient and selective amyloid inhibitor. |
| Pubmed ID | 9016963 9384377 |
| Domain | CDD:407439 |
| Functional Category | Others |
| Uniprot ID | P54379 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 228066 | 228314 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 363455 | 363703 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 189242 | 189490 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 229906 | 230154 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 222162 | 222410 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 221222 | 221470 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1788706 | 1788954 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3709699 | 3709947 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 219266 | 219514 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 257591 | 257839 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 11 | 207644 | 207892 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 245645 | 245893 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3149063 | 3149317 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 14 | 750055 | 750270 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 15 | 2010222 | 2010470 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 16 | 1637063 | 1637311 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2274825 | 2275079 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 18 | 3953419 | 3953670 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 19 | 1777061 | 1777315 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 20 | 1719829 | 1720083 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 1419164 | 1419418 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 22 | 1050607 | 1050861 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 23 | 2208154 | 2208408 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 24 | 1744221 | 1744475 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 25 | 80309 | 80563 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..