Result : A5FRY3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000688.1 |
| Organism | Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) |
| Left | 457937 |
| Right | 458134 |
| Strand | + |
| Nucleotide Sequence | ATGAATATAAGTGATATTCGCGGCCTTTCTGATACTGAAATAAAGAAGAAGCTTGAAGATTCCCATAAGGAGCTTTTTGAGCTCAGACTGAAGCTTTCTACCAGGCAGTTAGTAAATCACCGAGAGCTTCCCCGGGTAAAAAATGACATTGCCCGCATTCTAACCGTAATGCGTGAGCGCGAACTGCAGATAAGGTAG |
| Sequence | MNISDIRGLSDTEIKKKLEDSHKELFELRLKLSTRQLVNHRELPRVKNDIARILTVMRERELQIR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A5FRY3 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 142
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 400779 | 400976 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 2 | 184880 | 185077 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 3 | 1073066 | 1073263 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 4 | 474849 | 475079 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 5 | 777103 | 777333 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 6 | 2713810 | 2714034 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 7 | 489245 | 489475 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 8 | 6445004 | 6445186 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 9 | 2083385 | 2083618 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 10 | 367610 | 367807 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 11 | 4989390 | 4989614 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 12 | 375430 | 375660 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 13 | 2464260 | 2464442 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 14 | 368734 | 368940 | + | NZ_CP019688.1 | Corynebacterium glaucum |
| 15 | 2811115 | 2811339 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 16 | 4683329 | 4683553 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 17 | 228299 | 228502 | + | NZ_AP019367.1 | Parolsenella catena |
| 18 | 4779887 | 4780111 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 19 | 4766971 | 4767195 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 20 | 3564020 | 3564244 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 21 | 4021737 | 4021961 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 22 | 3648725 | 3648949 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 23 | 5992008 | 5992232 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 24 | 5677298 | 5677522 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 25 | 6049872 | 6050096 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 26 | 5601971 | 5602195 | + | NZ_CP022685.1 | Streptomyces formicae |
| 27 | 4167646 | 4167870 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 28 | 4154969 | 4155193 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 29 | 4110228 | 4110461 | - | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 30 | 3909011 | 3909235 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 31 | 4070903 | 4071127 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 32 | 4653447 | 4653671 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 33 | 4852371 | 4852595 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 34 | 4877596 | 4877820 | + | NZ_CP070242.1 | Streptomyces californicus |
| 35 | 4960904 | 4961128 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 36 | 4937399 | 4937623 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 37 | 3593025 | 3593249 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 38 | 3329745 | 3329969 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 39 | 1128211 | 1128441 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 40 | 628851 | 629081 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 41 | 331981 | 332217 | + | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 42 | 5334844 | 5335077 | + | NZ_CP033972.1 | Gordonia insulae |
| 43 | 4115546 | 4115782 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 44 | 3777450 | 3777686 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 45 | 151302 | 151499 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 46 | 157892 | 158089 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 47 | 3573692 | 3573925 | - | NZ_CP027433.1 | Gordonia iterans |
| 48 | 4469570 | 4469794 | + | NZ_CP029043.1 | Streptomyces nigra |
| 49 | 2234157 | 2234390 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 50 | 4284792 | 4285019 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 51 | 4057130 | 4057354 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 52 | 650674 | 650907 | + | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 53 | 3725978 | 3726202 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 54 | 2965839 | 2966063 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 55 | 2637185 | 2637409 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 56 | 4884646 | 4884816 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 57 | 4749110 | 4749280 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 58 | 1658935 | 1659171 | - | NZ_CP032788.1 | Corynebacterium xerosis |
| 59 | 3684572 | 3684796 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 60 | 4609230 | 4609454 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 61 | 4352011 | 4352235 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 62 | 4753661 | 4753885 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 63 | 4551838 | 4552062 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 64 | 4338489 | 4338713 | + | NZ_CP022310.1 | Streptomyces calvus |
| 65 | 3660250 | 3660474 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 66 | 5205309 | 5205533 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 67 | 3964675 | 3964899 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 68 | 4211516 | 4211740 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 69 | 4098366 | 4098590 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 70 | 9178234 | 9178458 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 71 | 6066057 | 6066281 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 72 | 895304 | 895528 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 73 | 5087121 | 5087345 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 74 | 5629352 | 5629576 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 75 | 4307377 | 4307613 | - | NZ_CP009896.1 | Pimelobacter simplex |
| 76 | 4559146 | 4559370 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 77 | 3049504 | 3049728 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 78 | 4609451 | 4609675 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 79 | 5073219 | 5073443 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 80 | 5310093 | 5310317 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 81 | 4622327 | 4622551 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 82 | 3546173 | 3546397 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 83 | 5254372 | 5254596 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 84 | 5448873 | 5449097 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 85 | 5617656 | 5617880 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 86 | 3941231 | 3941455 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 87 | 5730048 | 5730272 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 88 | 6600740 | 6600964 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 89 | 6308164 | 6308388 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 90 | 2935467 | 2935691 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 91 | 7660614 | 7660805 | - | NC_014666.1 | Frankia inefficax |
| 92 | 2251698 | 2251931 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 93 | 414861 | 415091 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 94 | 2474859 | 2475089 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 95 | 4268219 | 4268443 | + | NC_020990.1 | Streptomyces albidoflavus |
| 96 | 4570035 | 4570259 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 97 | 2863649 | 2863858 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 98 | 824720 | 824944 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 99 | 5380908 | 5381132 | + | NZ_CP027306.1 | Streptomyces atratus |
| 100 | 2767656 | 2767880 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 101 | 2748460 | 2748684 | - | NZ_CP031194.1 | Streptomyces paludis |
| 102 | 1512234 | 1512443 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 103 | 2126558 | 2126794 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 104 | 1086514 | 1086738 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 105 | 472383 | 472619 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 106 | 388701 | 388931 | + | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 107 | 4366290 | 4366487 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 108 | 1791557 | 1791754 | + | NZ_CP021434.1 | Tumebacillus avium |
| 109 | 536376 | 536606 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 110 | 566977 | 567207 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 111 | 421971 | 422204 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 112 | 713131 | 713361 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 113 | 565757 | 565987 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 114 | 1092498 | 1092701 | - | NC_017096.1 | Caldisericum exile AZM16c01 |
| 115 | 1129224 | 1129418 | - | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 116 | 556521 | 556751 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 117 | 1334547 | 1334783 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 118 | 370163 | 370393 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 119 | 473731 | 473961 | + | NZ_LR738855.1 | Corynebacterium rouxii |
| 120 | 1907797 | 1908027 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 121 | 388649 | 388879 | + | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 122 | 461646 | 461876 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 123 | 2580896 | 2581132 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 124 | 1959035 | 1959265 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 125 | 398112 | 398291 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 126 | 1534906 | 1535139 | - | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 127 | 1404099 | 1404332 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 128 | 2139161 | 2139391 | - | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 129 | 2506834 | 2507016 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 130 | 2471743 | 2471970 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 131 | 3230764 | 3230997 | + | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 132 | 1453128 | 1453364 | - | NZ_CP041146.1 | Nocardioides humi |
| 133 | 2247123 | 2247320 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 134 | 2837122 | 2837304 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 135 | 564747 | 564974 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 136 | 1273009 | 1273191 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 137 | 2038495 | 2038725 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 138 | 2055195 | 2055425 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 139 | 1835676 | 1835891 | - | NC_014363.1 | Olsenella uli DSM 7084 |
| 140 | 1123703 | 1123924 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 141 | 2745838 | 2746059 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 142 | 1007710 | 1007904 | - | NZ_CP013011.1 | Pyrodictium delaneyi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018258.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.99 | 141 | 1939 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.99 | 141 | 1939 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.99 | 141 | 1644 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 1.0 | 142 | 1252.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 1.0 | 142 | 425.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 1.0 | 142 | 425.0 | same-strand | KH domain |
| 7 | PF00252.20 | 0.99 | 141 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 1.0 | 142 | 0.0 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 0.77 | 109 | 392 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF17136.6 | 0.73 | 103 | 763 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 11 | PF00467.31 | 0.73 | 104 | 763.0 | same-strand | KOW motif |
| 12 | PF00673.23 | 0.69 | 98 | 1088.5 | same-strand | ribosomal L5P family C-terminus |
| 13 | PF00281.21 | 0.69 | 98 | 1088.5 | same-strand | Ribosomal protein L5 |
| 14 | PF00253.23 | 0.63 | 89 | 1650 | same-strand | Ribosomal protein S14p/S29e |
++ More..