Result : P54344
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phage-like element PBSX protein XtrA |
| NCBI Accession ID | Z70177.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3277 |
| Right | 3483 |
| Strand | + |
| Nucleotide Sequence | ATGATTCATCCGAAAAAACTGCTGCATATCGATTCCGTCACGCTTAAGAGCCAGCTGGAGGACGGGAAAATCCGTGTCATTATTGTGGACGGCATCAAGCAAGAAGCATGGATCACAGAAGCGCCAGAGCATGGAAAAACGCTCGTCGAAACAAGAAAGGGCGATCTTGCTCGTGTGGAATTTGAAATCGGCTACAAATTAAATTAA |
| Sequence | MIHPKKLLHIDSVTLKSQLEDGKIRVIIVDGIKQEAWITEAPEHGKTLVETRKGDLARVEFEIGYKLN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17356. Profile Description: Phage-like element PBSX protein XtrA. This is a family of unknown function found in Bacilli. |
| Pubmed ID | 8083174 9384377 |
| Domain | CDD:407452 |
| Functional Category | Others |
| Uniprot ID | P54344 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1324149 | 1324355 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1292607 | 1292813 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1297495 | 1297701 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1331629 | 1331835 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 661661 | 661867 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1241525 | 1241731 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 1491859 | 1492065 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2714651 | 2714854 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1246370 | 1246573 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1321960 | 1322163 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1423880 | 1424083 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1371998 | 1372201 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08281.14 | 1.0 | 12 | 115.5 | same-strand | Sigma-70, region 4 |
| 2 | PF04545.18 | 1.0 | 12 | 115.5 | same-strand | Sigma-70, region 4 |
| 3 | PF03592.18 | 0.92 | 11 | 742 | same-strand | Terminase small subunit |
| 4 | PF04466.15 | 0.92 | 11 | 1535 | same-strand | Phage terminase large subunit |
| 5 | PF17288.4 | 0.92 | 11 | 1535 | same-strand | Terminase RNAseH like domain |
| 6 | PF03237.17 | 0.75 | 9 | 1536 | same-strand | Terminase large subunit, T4likevirus-type, N-terminal |
| 7 | PF14550.8 | 0.92 | 11 | 4347 | same-strand | Putative phage serine protease XkdF |
++ More..