Protein Information |
Information Type | Description |
---|---|
Protein name | Phage-like element PBSX protein XtrA |
NCBI Accession ID | Z70177.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 3277 |
Right | 3483 |
Strand | + |
Nucleotide Sequence | ATGATTCATCCGAAAAAACTGCTGCATATCGATTCCGTCACGCTTAAGAGCCAGCTGGAGGACGGGAAAATCCGTGTCATTATTGTGGACGGCATCAAGCAAGAAGCATGGATCACAGAAGCGCCAGAGCATGGAAAAACGCTCGTCGAAACAAGAAAGGGCGATCTTGCTCGTGTGGAATTTGAAATCGGCTACAAATTAAATTAA |
Sequence | MIHPKKLLHIDSVTLKSQLEDGKIRVIIVDGIKQEAWITEAPEHGKTLVETRKGDLARVEFEIGYKLN |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17356. Profile Description: Phage-like element PBSX protein XtrA. This is a family of unknown function found in Bacilli. |
Pubmed ID | 8083174 9384377 |
Domain | CDD:407452 |
Functional Category | Others |
Uniprot ID | P54344 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1324149 | 1324355 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1292607 | 1292813 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 1297495 | 1297701 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 1331629 | 1331835 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 661661 | 661867 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1241525 | 1241731 | + | NZ_CP048852.1 | Bacillus tequilensis |
7 | 1491859 | 1492065 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 2714651 | 2714854 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 1246370 | 1246573 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 1321960 | 1322163 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 1423880 | 1424083 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 1371998 | 1372201 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08281.14 | 1.0 | 12 | 115.5 | same-strand | Sigma-70, region 4 |
2 | PF04545.18 | 1.0 | 12 | 115.5 | same-strand | Sigma-70, region 4 |
3 | PF03592.18 | 0.92 | 11 | 742 | same-strand | Terminase small subunit |
4 | PF04466.15 | 0.92 | 11 | 1535 | same-strand | Phage terminase large subunit |
5 | PF17288.4 | 0.92 | 11 | 1535 | same-strand | Terminase RNAseH like domain |
6 | PF03237.17 | 0.75 | 9 | 1536 | same-strand | Terminase large subunit, T4likevirus-type, N-terminal |
7 | PF14550.8 | 0.92 | 11 | 4347 | same-strand | Putative phage serine protease XkdF |