Protein Information |
Information Type | Description |
---|---|
Protein name | Phage-like element PBSX protein XkdR |
NCBI Accession ID | Z70177.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 19742 |
Right | 20008 |
Strand | + |
Nucleotide Sequence | ATGAGATTAAGTGAGGCTATAAAACATTTGGCAGTCGGCGCAGTTGACGCTGAGTCTCCGGTAGAACTGCTCCCGGCTGAAGTCGTTTCGGTTTCTCCTGTGGAAATCAAATTAAAAGAAAACAGCAAACTGATCATACCGGAAGACGCCATCATTATCCCAAAACGAATGCAGTCCGGAGGAGACGATGCACTCGAGCCGGGGGATCGCCTCATGACCGCGGCTCTGACTGGCGGGCAATCGTTTTTTATTTTAGATAAGGTATAG |
Sequence | MRLSEAIKHLAVGAVDAESPVELLPAEVVSVSPVEIKLKENSKLIIPEDAIIIPKRMQSGGDDALEPGDRLMTAALTGGQSFFILDKV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10844. Profile Description: Protein of unknown function (DUF2577). This family of proteins has no known function |
Pubmed ID | 9384377 |
Domain | CDD:402457 |
Functional Category | Others |
Uniprot ID | P54337 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1340609 | 1340875 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2670801 | 2671064 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 1313959 | 1314225 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 1349327 | 1349593 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 1257993 | 1258259 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 645119 | 645385 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 1509248 | 1509514 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 1310076 | 1310342 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
9 | 2697098 | 2697364 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 1263888 | 1264154 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
11 | 2510660 | 2510926 | + | NZ_CP043404.1 | Bacillus safensis |
12 | 2605355 | 2605621 | + | NZ_CP017786.1 | Bacillus xiamenensis |
13 | 2799207 | 2799473 | - | NZ_CP011150.1 | Bacillus altitudinis |
14 | 1199506 | 1199787 | + | NZ_CP011150.1 | Bacillus altitudinis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08890.13 | 1.0 | 12 | 6302.0 | same-strand | Phage XkdN-like tail assembly chaperone protein, TAC |
2 | PF01464.22 | 1.0 | 12 | 1645.0 | same-strand | Transglycosylase SLT domain |
3 | PF01476.22 | 1.0 | 12 | 993.0 | same-strand | LysM domain |
4 | PF10934.10 | 1.0 | 12 | 57.5 | same-strand | Protein of unknown function (DUF2634) |
5 | PF04865.16 | 1.0 | 12 | 475.5 | same-strand | Baseplate J-like protein |
6 | PF10076.11 | 1.0 | 12 | 1505.5 | same-strand | Uncharacterised protein conserved in bacteria (DUF2313) |