Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YpmT |
NCBI Accession ID | L77246.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 31179 |
Right | 31373 |
Strand | + |
Nucleotide Sequence | ATGAAACGGATTTACCAGTATTTCAGTTTATTATCCTTTACATTTTCCCTGTACTTCGGCTGGCTTGCTTATCATCATCTGGCTGCTGAAGATATGGATCAAATGTATTTGAATGTTTCCTATTGTGCCTTGTTCCTAAGTGTGATGGTGTTTACATTCGGTATGCGAGACCGAAAAAAAACCGATAAGTCATGA |
Sequence | MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALFLSVMVFTFGMRDRKKTDKS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17431. Profile Description: Uncharacterized ympT. This is a family of unknown function found in Bacillus. |
Pubmed ID | 8969496 9384377 |
Domain | CDD:407499 |
Functional Category | Others |
Uniprot ID | P54180 |
ORF Length (Amino Acid) | 64 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2290078 | 2290272 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2245415 | 2245609 | - | NZ_CP033052.1 | Bacillus vallismortis |
3 | 2159325 | 2159519 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 3966439 | 3966633 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 2167185 | 2167379 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 2087933 | 2088127 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 2099210 | 2099404 | - | NZ_CP013984.1 | Bacillus inaquosorum |
8 | 2262354 | 2262554 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
9 | 2363711 | 2363911 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
10 | 1989231 | 1989428 | - | NZ_CP011150.1 | Bacillus altitudinis |
11 | 3299112 | 3299309 | + | NZ_CP043404.1 | Bacillus safensis |
12 | 3390085 | 3390282 | + | NZ_CP017786.1 | Bacillus xiamenensis |
13 | 2467476 | 2467667 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01641.20 | 0.77 | 10 | 2550.0 | same-strand | SelR domain |
2 | PF01625.23 | 0.85 | 11 | 2016 | same-strand | Peptide methionine sulfoxide reductase |
3 | PF01047.24 | 1.0 | 13 | 1460 | opposite-strand | MarR family |
4 | PF13463.8 | 1.0 | 13 | 1460 | opposite-strand | Winged helix DNA-binding domain |
5 | PF12802.9 | 1.0 | 13 | 1460 | opposite-strand | MarR family |
6 | PF01554.20 | 0.77 | 10 | 73.0 | same-strand | MatE |
7 | PF09911.11 | 1.0 | 13 | 13 | same-strand | Uncharacterized protein conserved in bacteria (DUF2140) |
8 | PF13472.8 | 1.0 | 13 | 586 | same-strand | GDSL-like Lipase/Acylhydrolase family |
9 | PF00657.24 | 1.0 | 13 | 586 | same-strand | GDSL-like Lipase/Acylhydrolase |
10 | PF02630.16 | 1.0 | 13 | 1431 | same-strand | SCO1/SenC |
11 | PF08534.12 | 1.0 | 13 | 1431 | same-strand | Redoxin |
12 | PF10751.11 | 1.0 | 13 | 2169 | same-strand | Protein of unknown function (DUF2535) |
13 | PF00578.23 | 0.85 | 11 | 1432 | same-strand | AhpC/TSA family |