| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpmP |
| NCBI Accession ID | L77246.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 28768 |
| Right | 29019 |
| Strand | + |
| Nucleotide Sequence | TTGTTACTCAAAAGCCTAGAGTTCAAACGCGGTGACGGGATTCAGGTGAAAGTGACAGAAATACCTGTATTAAAGGAAGATGAGCACTATTTCTTTATGTTACATCACCATTTGCAATTCTACTTAAAAGAAGTGTTTTCATCAAACAGCAGGGCAAAAGTGTATTCTTTCCGACATTATATGAAGCGGCGGATGAAGTGGGCAGATTATCAGGCTGTATTTCATCAAGAGGTGTTAAAGCACAACGCGTAA |
| Sequence | MLLKSLEFKRGDGIQVKVTEIPVLKEDEHYFFMLHHHLQFYLKEVFSSNSRAKVYSFRHYMKRRMKWADYQAVFHQEVLKHNA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10751. Profile Description: Protein of unknown function (DUF2535). This family of proteins with unknown function appears to be restricted to Bacillus spp. |
| Pubmed ID | 8969496 9384377 |
| Domain | CDD:313866 |
| Functional Category | Others |
| Uniprot ID | P54177 |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2292432 | 2292683 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2101566 | 2101817 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2161684 | 2161935 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2169544 | 2169795 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2247766 | 2248017 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2090292 | 2090543 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3964019 | 3964270 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1820742 | 1820993 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2135008 | 2135259 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2470748 | 2470999 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2367009 | 2367260 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2265653 | 2265904 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3386759 | 3387010 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 3295784 | 3296035 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1992503 | 1992754 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 2987031 | 2987282 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17431.4 | 0.81 | 13 | 2169 | same-strand | Uncharacterized YmpT-like |
| 2 | PF09911.11 | 0.94 | 15 | 1590 | same-strand | Uncharacterized protein conserved in bacteria (DUF2140) |
| 3 | PF13472.8 | 0.94 | 15 | 813 | same-strand | GDSL-like Lipase/Acylhydrolase family |
| 4 | PF00657.24 | 0.94 | 15 | 813 | same-strand | GDSL-like Lipase/Acylhydrolase |
| 5 | PF02630.16 | 0.94 | 15 | 150 | same-strand | SCO1/SenC |
| 6 | PF08534.12 | 0.88 | 14 | 151.5 | same-strand | Redoxin |
| 7 | PF00291.27 | 1.0 | 16 | 89.0 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 8 | PF00585.20 | 1.0 | 16 | 89.0 | same-strand | C-terminal regulatory domain of Threonine dehydratase |
| 9 | PF14532.8 | 0.94 | 15 | 1595 | opposite-strand | Sigma-54 interaction domain |
| 10 | PF08461.12 | 0.62 | 10 | 1601.5 | opposite-strand | Ribonuclease R winged-helix domain |
| 11 | PF03006.22 | 0.94 | 15 | 2612 | opposite-strand | Haemolysin-III related |
| 12 | PF00186.21 | 1.0 | 16 | 3912.5 | same-strand | Dihydrofolate reductase |
| 13 | PF00578.23 | 0.81 | 13 | 153 | same-strand | AhpC/TSA family |