Result : P54165
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpeQ |
| NCBI Accession ID | L77246.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 12476 |
| Right | 12658 |
| Strand | + |
| Nucleotide Sequence | TTGGATAAGAAAATGATCTTTAAAGAACTGACAGAACTGCACGATGAATATTGCAAGGACTGTTTTATTAAGAAGCAGTTTCGCAAAGAATTTGGCAAAACTTATGCGCATTCATTTTGTATCAATAAATGTACGGTTGGTGAAAAGTTGAAACAATACGGAGATGTCTTAACCAATCACTAA |
| Sequence | MDKKMIFKELTELHDEYCKDCFIKKQFRKEFGKTYAHSFCINKCTVGEKLKQYGDVLTNH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10782. Profile Description: Zinc-finger. This bacterial family of proteins is a zinc-finger domain of the C2HC type with an additional cysteine. |
| Pubmed ID | 8969496 9384377 |
| Domain | CDD:402422 |
| Functional Category | Others |
| Uniprot ID | P54165 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2308792 | 2308974 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2117920 | 2118102 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2178065 | 2178247 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2185858 | 2186040 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2264401 | 2264583 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2106696 | 2106878 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3947686 | 3947868 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1805213 | 1805395 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2150604 | 2150786 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2283900 | 2284085 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2385250 | 2385435 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2491267 | 2491452 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3368548 | 3368730 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2010802 | 2010984 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3277553 | 3277735 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1440350 | 1440532 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 1978051 | 1978215 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 803620 | 803838 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 2618320 | 2618523 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1315694 | 1315882 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 1373409 | 1373591 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 22 | 828525 | 828707 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 23 | 1582660 | 1582848 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 24 | 462626 | 462808 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 25 | 1669184 | 1669360 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 26 | 2609867 | 2610052 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 27 | 1995493 | 1995675 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 28 | 4746354 | 4746539 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 29 | 1989227 | 1989400 | - | NZ_CP012024.1 | Bacillus smithii |
| 30 | 420291 | 420476 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 31 | 264078 | 264254 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 32 | 1808059 | 1808250 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 33 | 2859059 | 2859250 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 34 | 2136955 | 2137134 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 35 | 3055285 | 3055476 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 36 | 3552557 | 3552733 | - | NZ_CP040336.1 | Bacillus luti |
| 37 | 1543874 | 1544050 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 38 | 1534807 | 1534983 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 39 | 1591297 | 1591473 | + | NC_011725.1 | Bacillus cereus B4264 |
| 40 | 1548934 | 1549110 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 41 | 3293951 | 3294148 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 42 | 3793158 | 3793337 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 43 | 4377935 | 4378114 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 44 | 3335375 | 3335536 | + | NZ_CP013661.2 | Planococcus kocurii |
| 45 | 1872413 | 1872574 | - | NZ_CP019401.1 | Planococcus faecalis |
| 46 | 1850275 | 1850475 | - | NZ_CP016540.2 | Planococcus versutus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00313.24 | 0.87 | 40 | 586.0 | opposite-strand | 'Cold-shock' DNA-binding domain |
| 2 | PF10819.10 | 0.65 | 30 | 34.5 | opposite-strand | Protein of unknown function (DUF2564) |
| 3 | PF13456.8 | 0.98 | 45 | 40.5 | same-strand | Reverse transcriptase-like |
| 4 | PF00075.26 | 0.8 | 37 | 873 | opposite-strand | RNase H |
++ More..