Result : P54160
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpbS |
| NCBI Accession ID | L77246.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8986 |
| Right | 9243 |
| Strand | + |
| Nucleotide Sequence | ATGTCAGAGGTACATAAAGCAATTTCAGCACATTCATCAAAACAGCACGAGCATATCAAAGCATTTATGCGTCTTGAAAATATGCGTGAATTGGCGATTGAAGAAGCTGTTGCTAAATGCAGAAACGATGAGCCTTATACTACAGATGCAATTAATGAAATTACCGAGCAAATGAATCAGCTCGCTAAAAAAGGCATCGTCCCGACAAGACGGCTTGTATCAAAAGAAATGGTCAGAGAATACGTAAGCCGCATGTAA |
| Sequence | MSEVHKAISAHSSKQHEHIKAFMRLENMRELAIEEAVAKCRNDEPYTTDAINEITEQMNQLAKKGIVPTRRLVSKEMVREYVSRM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10752. Profile Description: Protein of unknown function (DUF2533). This family of proteins with unknown function appears to be restricted to Bacillus spp. |
| Pubmed ID | 8969496 9384377 |
| Domain | CDD:313867 |
| Functional Category | Others |
| Uniprot ID | P54160 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 37
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2312207 | 2312464 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2181479 | 2181736 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2121335 | 2121592 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2267821 | 2268078 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2189271 | 2189528 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2110111 | 2110368 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3944201 | 3944458 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2154010 | 2154267 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1801733 | 1801990 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2287325 | 2287594 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2388674 | 2388943 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2494697 | 2494966 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 1500809 | 1501072 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 14 | 3274087 | 3274350 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 1776724 | 1776999 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 16 | 774561 | 774836 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 17 | 1785284 | 1785556 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 18 | 3365028 | 3365291 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 19 | 2014211 | 2014474 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 20 | 1597009 | 1597284 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 21 | 1075630 | 1075905 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 22 | 2343872 | 2344147 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 23 | 1664420 | 1664689 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 24 | 1446345 | 1446617 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 2873553 | 2873831 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 26 | 1959670 | 1959948 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 27 | 1410560 | 1410781 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 28 | 4423149 | 4423358 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 29 | 2100972 | 2101241 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 30 | 1437436 | 1437693 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 31 | 2660409 | 2660675 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 32 | 1506085 | 1506357 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 33 | 1553659 | 1553931 | + | NC_011725.1 | Bacillus cereus B4264 |
| 34 | 3580254 | 3580526 | - | NZ_CP040336.1 | Bacillus luti |
| 35 | 1505022 | 1505294 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 36 | 1664540 | 1664797 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 37 | 1521080 | 1521352 | + | NZ_CP032365.1 | Bacillus wiedmannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00350.25 | 0.95 | 35 | 182 | same-strand | Dynamin family |
| 2 | PF01926.25 | 0.95 | 35 | 182 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF04140.16 | 0.73 | 27 | 3985 | same-strand | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |
| 4 | PF04191.15 | 0.65 | 24 | 3999.5 | same-strand | Phospholipid methyltransferase |
| 5 | PF02797.17 | 0.73 | 27 | 4499 | same-strand | Chalcone and stilbene synthases, C-terminal domain |
| 6 | PF08541.12 | 0.73 | 27 | 4499 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
++ More..