Result : P52221
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Heme exporter protein D (Cytochrome c-type biogenesis protein CcmD) |
| NCBI Accession ID | Z71971.1 |
| Organism | Paracoccus denitrificans (strain Pd 1222) |
| Left | 2972 |
| Right | 3115 |
| Strand | + |
| Nucleotide Sequence | ATGACCGAACTTGGCAAATATGCCGGAACCGTCCTGGCCGCCTATGGCGCGAGCCTGGTGCTGCTGATCGGCATCGTCGTCCAGACCGTGCTGGCCAATGCCCGCGCCCGCCGCGAATTGCAGGAGCATGAGCGCCGTGGCTAG |
| Sequence | MTELGKYAGTVLAAYGASLVLLIGIVVQTVLANARARRELQEHERRG |
| Source of smORF | Swiss-Prot |
| Function | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes. {ECO:0000305}. |
| Pubmed ID | 9220005 |
| Domain | CDD:416290 |
| Functional Category | Others |
| Uniprot ID | P52221 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1788560 | 1788703 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 2 | 1511879 | 1512022 | - | NZ_CP045073.1 | Paracoccus kondratievae |
| 3 | 3041813 | 3041956 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 4 | 918633 | 918776 | + | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 5 | 3274603 | 3274746 | - | NZ_CP024422.1 | Paracoccus yeei |
| 6 | 2394410 | 2394553 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 7 | 3229334 | 3229477 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 8 | 1559425 | 1559580 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 9 | 384022 | 384186 | + | NZ_CP025583.1 | Paracoccus jeotgali |
| 10 | 1306107 | 1306256 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 11 | 2200762 | 2200905 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 12 | 1364255 | 1364419 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 13 | 1747848 | 1748003 | - | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 14 | 2289535 | 2289696 | - | NZ_CP012661.1 | Defluviimonas alba |
| 15 | 2175377 | 2175532 | - | NZ_CP048788.1 | Roseobacter ponti |
| 16 | 2451521 | 2451679 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN832559.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08534.12 | 0.88 | 14 | -7.0 | same-strand | Redoxin |
| 2 | PF00578.23 | 0.94 | 15 | -7 | same-strand | AhpC/TSA family |
| 3 | PF13905.8 | 0.75 | 12 | -7.0 | same-strand | Thioredoxin-like |
| 4 | PF01578.22 | 0.94 | 15 | -3 | same-strand | Cytochrome C assembly protein |
| 5 | PF03379.15 | 0.94 | 15 | 779 | same-strand | CcmB protein |
| 6 | PF00005.29 | 0.88 | 14 | 1430.0 | same-strand | ABC transporter |
| 7 | PF04430.16 | 0.88 | 14 | 2065.0 | same-strand | Protein of unknown function (DUF498/DUF598) |
| 8 | PF02355.18 | 0.69 | 11 | 2412.5 | same-strand | Protein export membrane protein |
++ More..