Result : P50841
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YptA |
| NCBI Accession ID | L47838.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 14561 |
| Right | 14752 |
| Strand | + |
| Nucleotide Sequence | ATGCTGAACAGCGAACATTTTAATCTTATTCAAAGGGCGCTTGACGCAACAGCAAACGAGCTGAAGGAGCTCGGGACTGATTCGTCTCCGTCTGTGATTTCGCATGCGCAAACTGATTTAGAAAAAGCGGTAGAACATATTTATTCAACAGACCATCCTTTTTTATCGTCGCATGTGATCAATCGTAAGTAA |
| Sequence | MLNSEHFNLIQRALDATANELKELGTDSSPSVISHAQTDLEKAVEHIYSTDHPFLSSHVINRK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8760912 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P50841 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2329515 | 2329706 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2138646 | 2138837 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2198794 | 2198985 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2201639 | 2201830 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2285130 | 2285321 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2127438 | 2127635 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3926937 | 3927131 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1786296 | 1786487 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2213478 | 2213669 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00294.26 | 0.67 | 6 | 4944.0 | same-strand | pfkB family carbohydrate kinase |
| 2 | PF13377.8 | 0.67 | 6 | 3887.5 | same-strand | Periplasmic binding protein-like domain |
| 3 | PF00532.23 | 0.67 | 6 | 3887.5 | same-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 4 | PF00356.23 | 0.67 | 6 | 3887.5 | same-strand | Bacterial regulatory proteins, lacI family |
| 5 | PF13407.8 | 0.67 | 6 | 3887.5 | same-strand | Periplasmic binding protein domain |
| 6 | PF04962.14 | 0.67 | 6 | 2838.0 | opposite-strand | KduI/IolB family |
| 7 | PF13561.8 | 0.67 | 6 | 2072.0 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 8 | PF00106.27 | 0.67 | 6 | 2072.0 | opposite-strand | short chain dehydrogenase |
| 9 | PF08659.12 | 0.67 | 6 | 2072.0 | opposite-strand | KR domain |
| 10 | PF13307.8 | 1.0 | 9 | 104 | same-strand | Helicase C-terminal domain |
| 11 | PF01170.20 | 1.0 | 9 | 367 | same-strand | Putative RNA methylase family UPF0020 |
| 12 | PF02926.19 | 1.0 | 9 | 367 | same-strand | THUMP domain |
| 13 | PF06908.13 | 1.0 | 9 | 2446 | same-strand | YspA SLOG family |
| 14 | PF14139.8 | 0.78 | 7 | 163 | opposite-strand | YpzG-like protein |
++ More..