Result : P50834
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YppF |
| NCBI Accession ID | L47838.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 5497 |
| Right | 5685 |
| Strand | - |
| Nucleotide Sequence | ATGAACGTATCATACTTAAGCAAACGTTTTGCAGAAATGAAGAAATATGAAACAGACTGTATGAATAAACTGATGGACTTTGCCAAGTTCCTCTATATTCAAGGACATCTCAGCATAACTGAGTTTCGTAACAGTATGAAGGTTCTCGAAGCAAATGGAGCAGAAAGCCCGGCATATGAGATGAATTAA |
| Sequence | MNVSYLSKRFAEMKKYETDCMNKLMDFAKFLYIQGHLSITEFRNSMKVLEANGAESPAYEMN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14178. Profile Description: YppF-like protein. The YppF-like protein family includes the B. subtilis YppF protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved LLDF sequence motif. |
| Pubmed ID | 8760912 9384377 |
| Domain | CDD:290882 |
| Functional Category | Others |
| Uniprot ID | P50834 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2338582 | 2338770 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2207856 | 2208044 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2147719 | 2147907 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2210703 | 2210891 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2294196 | 2294384 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3917869 | 3918057 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2136510 | 2136698 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1777146 | 1777328 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2222606 | 2222788 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2309391 | 2309591 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2411588 | 2411788 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2531670 | 2531870 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13482.8 | 0.92 | 11 | 4017 | opposite-strand | RNase H superfamily |
| 2 | PF00270.31 | 0.92 | 11 | 1751 | opposite-strand | DEAD/DEAH box helicase |
| 3 | PF09369.12 | 0.92 | 11 | 1751 | opposite-strand | Domain of unknown function (DUF1998) |
| 4 | PF00271.33 | 1.0 | 12 | 1751.5 | opposite-strand | Helicase conserved C-terminal domain |
| 5 | PF04851.17 | 0.83 | 10 | 1751.5 | opposite-strand | Type III restriction enzyme, res subunit |
| 6 | PF00358.22 | 1.0 | 12 | 1139.0 | opposite-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 7 | PF14179.8 | 1.0 | 12 | 187.0 | opposite-strand | YppG-like protein |
| 8 | PF08807.12 | 1.0 | 12 | 39.0 | opposite-strand | Bacterial domain of unknown function (DUF1798) |
| 9 | PF17522.4 | 1.0 | 12 | 454.5 | opposite-strand | Family of unknown function (DUF5446) |
| 10 | PF10720.11 | 1.0 | 12 | 1028.0 | opposite-strand | Protein of unknown function (DUF2515) |
| 11 | PF03838.16 | 1.0 | 12 | 2033.0 | same-strand | Recombination protein U |
++ More..