Result : P50832
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YppD |
| NCBI Accession ID | L47838.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4796 |
| Right | 5041 |
| Strand | + |
| Nucleotide Sequence | ATGTCCGGTTATGTATGCAAGACAGATATTCTCCGTATGCTTTCTGATATAGAAGATGAATTAACGCGAGCTGAGCAAAGCCTGAATCATTCTGTAAATGCATTAGAGGCTGAGATGCGGGAAACGGAGAACGATCGCCTAAGTGTGCTCGAAGAAGAAATCATAGATCTTCATATTTGTATAAATGAGCTGTATCAATCGCCTGAACACAGGTATGCGTTTGAGAAGGTATACCGCATCGGCTGA |
| Sequence | MSGYVCKTDILRMLSDIEDELTRAEQSLNHSVNALEAEMRETENDRLSVLEEEIIDLHICINELYQSPEHRYAFEKVYRIG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17522. Profile Description: Family of unknown function (DUF5446). This is a family of unknown function found in Bacillales. |
| Pubmed ID | 8760912 9384377 |
| Domain | CDD:340237 |
| Functional Category | Others |
| Uniprot ID | P50832 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2339226 | 2339471 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2148363 | 2148608 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2296426 | 2296671 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2208501 | 2208746 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2211335 | 2211580 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2137151 | 2137396 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3917172 | 3917417 | + | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00358.22 | 0.86 | 6 | 1756.5 | same-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 2 | PF14179.8 | 1.0 | 7 | 831 | same-strand | YppG-like protein |
| 3 | PF14178.8 | 1.0 | 7 | 456 | opposite-strand | YppF-like protein |
| 4 | PF08807.12 | 1.0 | 7 | 43 | same-strand | Bacterial domain of unknown function (DUF1798) |
| 5 | PF10720.11 | 1.0 | 7 | 328 | same-strand | Protein of unknown function (DUF2515) |
| 6 | PF03838.16 | 1.0 | 7 | 1331 | opposite-strand | Recombination protein U |
| 7 | PF00912.24 | 1.0 | 7 | 1973 | opposite-strand | Transglycosylase |
| 8 | PF00905.24 | 1.0 | 7 | 1973 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 9 | PF00041.23 | 0.86 | 6 | 1973.0 | opposite-strand | Fibronectin type III domain |
++ More..