Result : P50744
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YphE |
| NCBI Accession ID | L47648.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 23887 |
| Right | 24090 |
| Strand | + |
| Nucleotide Sequence | TTGAATCTGGCATTGATGAAAATGTGGTTTGCTCTAGGGTCCATGGGTCTGATGTTTCTGGCTGTAGCTTCCATCTATTTAAGCCGCTTTAAGTGCCAAAACCGTTTTTTGAAGATTGCGATTTCATCATTCGCATACATGTGTATGCTCATATCTGGAATTATTGTGTTTGTCGTGGTTTTTAGCGGCCCTGTCAATGAATAA |
| Sequence | MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFAYMCMLISGIIVFVVVFSGPVNE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10966. Profile Description: Protein of unknown function (DUF2768). This family of proteins with unknown function appear to be restricted to Bacillus spp. |
| Pubmed ID | 8760912 9384377 |
| Domain | CDD:402513 |
| Functional Category | Others |
| Uniprot ID | P50744 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2388610 | 2388813 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2257909 | 2258112 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3867817 | 3868020 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2260709 | 2260912 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2197771 | 2197974 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2186535 | 2186738 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2345802 | 2346005 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 3292945 | 3293148 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 9 | 2086774 | 2086977 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 10 | 3201859 | 3202062 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 2273805 | 2274008 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 12 | 1725960 | 1726142 | + | NZ_CP011937.1 | Bacillus velezensis |
| 13 | 2359461 | 2359664 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 2461623 | 2461826 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2583224 | 2583427 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 1333683 | 1333886 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 17 | 3700594 | 3700797 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 18 | 1444229 | 1444432 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 19 | 1460568 | 1460771 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 20 | 3642194 | 3642397 | - | NZ_CP040336.1 | Bacillus luti |
| 21 | 1442919 | 1443122 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 1717181 | 1717384 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 1493033 | 1493236 | + | NC_011725.1 | Bacillus cereus B4264 |
| 24 | 3124997 | 3125200 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 1832568 | 1832750 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 26 | 1577922 | 1578122 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 27 | 3574128 | 3574328 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 28 | 3624601 | 3624801 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 29 | 4114165 | 4114335 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 30 | 2546337 | 2546537 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 31 | 1855255 | 1855419 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 32 | 2320719 | 2320922 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 33 | 4291949 | 4292125 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02081.17 | 0.76 | 25 | 3855 | same-strand | Tryptophan RNA-binding attenuator protein |
| 2 | PF01227.24 | 0.97 | 32 | 3257.5 | same-strand | GTP cyclohydrolase I |
| 3 | PF00216.23 | 1.0 | 33 | 2798 | same-strand | Bacterial DNA-binding protein |
| 4 | PF09547.12 | 1.0 | 33 | 949 | same-strand | Stage IV sporulation protein A (spore IV A) |
| 5 | PF01926.25 | 1.0 | 33 | 1354.0 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF07479.16 | 1.0 | 33 | 338 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
| 7 | PF01210.25 | 1.0 | 33 | 338 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
| 8 | PF03807.19 | 0.97 | 32 | 337.5 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 9 | PF14714.8 | 1.0 | 33 | 1394 | same-strand | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal |
| 10 | PF02421.20 | 1.0 | 33 | 1394 | same-strand | Ferrous iron transport protein B |
| 11 | PF14045.8 | 0.79 | 26 | 3049.0 | same-strand | YIEGIA protein |
++ More..