Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YphE |
NCBI Accession ID | L47648.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 23887 |
Right | 24090 |
Strand | + |
Nucleotide Sequence | TTGAATCTGGCATTGATGAAAATGTGGTTTGCTCTAGGGTCCATGGGTCTGATGTTTCTGGCTGTAGCTTCCATCTATTTAAGCCGCTTTAAGTGCCAAAACCGTTTTTTGAAGATTGCGATTTCATCATTCGCATACATGTGTATGCTCATATCTGGAATTATTGTGTTTGTCGTGGTTTTTAGCGGCCCTGTCAATGAATAA |
Sequence | MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFAYMCMLISGIIVFVVVFSGPVNE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10966. Profile Description: Protein of unknown function (DUF2768). This family of proteins with unknown function appear to be restricted to Bacillus spp. |
Pubmed ID | 8760912 9384377 |
Domain | CDD:402513 |
Functional Category | Others |
Uniprot ID | P50744 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2388610 | 2388813 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2257909 | 2258112 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 3867817 | 3868020 | + | NZ_CP029364.1 | Bacillus halotolerans |
4 | 2260709 | 2260912 | - | NZ_CP048852.1 | Bacillus tequilensis |
5 | 2197771 | 2197974 | - | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 2186535 | 2186738 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 2345802 | 2346005 | - | NZ_CP033052.1 | Bacillus vallismortis |
8 | 3292945 | 3293148 | + | NZ_CP017786.1 | Bacillus xiamenensis |
9 | 2086774 | 2086977 | - | NZ_CP011150.1 | Bacillus altitudinis |
10 | 3201859 | 3202062 | + | NZ_CP043404.1 | Bacillus safensis |
11 | 2273805 | 2274008 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
12 | 1725960 | 1726142 | + | NZ_CP011937.1 | Bacillus velezensis |
13 | 2359461 | 2359664 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
14 | 2461623 | 2461826 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
15 | 2583224 | 2583427 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
16 | 1333683 | 1333886 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
17 | 3700594 | 3700797 | + | NZ_CP022983.1 | Cytobacillus kochii |
18 | 1444229 | 1444432 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
19 | 1460568 | 1460771 | + | NZ_CP032365.1 | Bacillus wiedmannii |
20 | 3642194 | 3642397 | - | NZ_CP040336.1 | Bacillus luti |
21 | 1442919 | 1443122 | + | NZ_CP064875.1 | Bacillus toyonensis |
22 | 1717181 | 1717384 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
23 | 1493033 | 1493236 | + | NC_011725.1 | Bacillus cereus B4264 |
24 | 3124997 | 3125200 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
25 | 1832568 | 1832750 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
26 | 1577922 | 1578122 | + | NZ_CP016020.1 | Bacillus weihaiensis |
27 | 3574128 | 3574328 | - | NZ_CP017703.1 | Aeribacillus pallidus |
28 | 3624601 | 3624801 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
29 | 4114165 | 4114335 | - | NZ_CP024035.1 | Priestia aryabhattai |
30 | 2546337 | 2546537 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
31 | 1855255 | 1855419 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
32 | 2320719 | 2320922 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
33 | 4291949 | 4292125 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02081.17 | 0.76 | 25 | 3855 | same-strand | Tryptophan RNA-binding attenuator protein |
2 | PF01227.24 | 0.97 | 32 | 3257.5 | same-strand | GTP cyclohydrolase I |
3 | PF00216.23 | 1.0 | 33 | 2798 | same-strand | Bacterial DNA-binding protein |
4 | PF09547.12 | 1.0 | 33 | 949 | same-strand | Stage IV sporulation protein A (spore IV A) |
5 | PF01926.25 | 1.0 | 33 | 1354.0 | same-strand | 50S ribosome-binding GTPase |
6 | PF07479.16 | 1.0 | 33 | 338 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus |
7 | PF01210.25 | 1.0 | 33 | 338 | same-strand | NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus |
8 | PF03807.19 | 0.97 | 32 | 337.5 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
9 | PF14714.8 | 1.0 | 33 | 1394 | same-strand | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal |
10 | PF02421.20 | 1.0 | 33 | 1394 | same-strand | Ferrous iron transport protein B |
11 | PF14045.8 | 0.79 | 26 | 3049.0 | same-strand | YIEGIA protein |