Result : P50500

Protein Information

• Protein name: Iron oxidase (EC 1.16.3.-) (Fe(II) oxidase)
• NCBI Accession ID: X57324.1
• Organism: Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans)
• Left: 1960
• Right: 2232
• Strand: +
• Nucleotide Sequence: ATGAGTGAAAAGGACAAGATGATTACCCGTCGCGATGCGCTGAGAAATATTGCGGTTGTCGTCGGATCGGTGGCTACCACGACGATGATGGGCGTCGGTGTGGCAGATGCTGGAAGCATGCCTAAGGCAGCGGTGCAATATCAGGATACACCTAAAGGCAAGGACCACTGTTCAGTCTGTGCGCAGTTTATTGCTCCACATAGTTGTAAGGTGGTGGCGGGTAACATCAGCCCCAATGGCTGGTGTGTAGCCTTTGTTCCTAAGTCAGCATGA
• Sequence: MSEKDKMITRRDALRNIAVVVGSVATTTMMGVGVADAGSMPKAAVQYQDTPKGKDHCSVCAQFIAPHSCKVVAGNISPNGWCVAFVPKSA
• Source of smORF: Swiss-Prot
• Function: Catalyzes the oxidation of Fe(2+) to Fe(3+) coupled to cytochrome c552 reduction.
• Pubmed ID: 1317860
• Functional Category: Metal-binding
• Uniprot ID: P50500
• ORF Length (Amino Acid): 90

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1443639	1443911	+	NC_015942.1	Acidithiobacillus ferrivorans SS3
2	671012	671332	+	NZ_AP018795.1	Acidithiobacillus ferridurans
3	2434085	2434405	+	NC_011761.1	Acidithiobacillus ferrooxidans ATCC 23270

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_AP018795.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00034.23	0.67	2	3519.0	same-strand	Cytochrome c
2	PF13442.8	0.67	2	3519.0	same-strand	Cytochrome C oxidase, cbb3-type, subunit III
3	PF00106.27	0.67	2	2704.0	same-strand	short chain dehydrogenase
4	PF10399.11	0.67	2	2053.0	same-strand	Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
5	PF00033.21	0.67	2	811.0	same-strand	Cytochrome b/b6/petB
6	PF13631.8	0.67	2	811.0	same-strand	Cytochrome b(N-terminal)/b6/petB
7	PF00032.19	0.67	2	811.0	same-strand	Cytochrome b(C-terminal)/b6/petD
8	PF02167.17	0.67	2	87.0	same-strand	Cytochrome C1 family
9	PF01292.22	0.67	2	727.5	same-strand	Prokaryotic cytochrome b561
10	PF01728.21	0.67	2	1490.5	opposite-strand	FtsJ-like methyltransferase
11	PF01985.23	0.67	2	2242.5	same-strand	CRS1 / YhbY (CRM) domain